Alphabet Broderie Point De Tige

  • The Kooples - Robe longue écrue boutonnée à broderies - FEMME 4
    Cette robe longue d'été est placée sous le signe de la tendance romantique et bohème du Printemps-Été 2021. Elle ressemble les détails incontournables de la collection: une encolure en pointe élégante, de longues manches bouffantes et une rangée de boutons recouverts qui descend le long du devant. Son étoffe immaculée est rehaussée de fines broderies ton sur ton, qui représentent de petites fleurs de saison. Faites de cette robe légère un indispensable, portée avec une ceinture et des bottines. - BEIGE - FEMME
  • Riolis RI-1123 Kit de Broderie au Point de Croix Naissance Fille Rose
    La toile Zweigart Aïda blanche 5.5 points/cm Les fils Anchor 10 couleurs Le diagramme en couleurs Une aiguille Les explications en Français, Russe, Anglais, Allemand, Espagnole et Italien. Création de Anna Korol Couleur: Rose
  • The Kooples - Robe longue écrue boutonnée à broderies - FEMME 3
    Cette robe longue d'été est placée sous le signe de la tendance romantique et bohème du Printemps-Été 2021. Elle ressemble les détails incontournables de la collection: une encolure en pointe élégante, de longues manches bouffantes et une rangée de boutons recouverts qui descend le long du devant. Son étoffe immaculée est rehaussée de fines broderies ton sur ton, qui représentent de petites fleurs de saison. Faites de cette robe légère un indispensable, portée avec une ceinture et des bottines. - BEIGE - FEMME
  • Kamaca Kit de broderie de nappe en coton Point de tige, point plat Papillons + fleurs Broderie aiguilletée préimprimée avec modèle
    Magnifique kit de broderie de nappe à broder, motif papillons + fleurs, point de tige, passé plat, broderie aiguilletée pré-imprimée, nappe et fil à broder en coton, finition ourlée avec bordure décorative tissée, qualité supérieure, prêt à l’emploi, à broder soi-même, de la marque Kamaca. Article de qualité supérieure à 100 % en coton, technique de broderie : Point de tige, passé plat, broderie aiguilletée, point noué. Nappe et fil à broder à 100 % en coton, bordure décorative tissée, qualité supérieure. Cette nappe est lavable à la main – Nous vous recommandons de la laver à la main afin de préserver votre précieux travail. -
  • The Kooples - Robe longue écrue boutonnée à broderies - FEMME 0
    Cette robe longue d'été est placée sous le signe de la tendance romantique et bohème du Printemps-Été 2021. Elle ressemble les détails incontournables de la collection: une encolure en pointe élégante, de longues manches bouffantes et une rangée de boutons recouverts qui descend le long du devant. Son étoffe immaculée est rehaussée de fines broderies ton sur ton, qui représentent de petites fleurs de saison. Faites de cette robe légère un indispensable, portée avec une ceinture et des bottines. - BEIGE - FEMME
  • Reofrey Boîte Aveugle aléatoire Diamond Painting 5D Diamant Peinture,Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Une mystérieuse boîte aveugle en diamant est le meilleur défi pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de quelques mystères et de surprises. En ce moment, une mystérieuse peinture au diamant aveugle est le meilleur cadeau pour vous-même. 【CADEAU INCONNU】 Les peintures au diamant dans nos boîtes aveugles sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre,etc. la peinture au diamant est là! Il y aura toujours une peinture au diamant qui attire votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design complet du diamant, une prise en compte complète des détails, rendez votre art du diamant plus complet, vous permet de l'apprécier davantage du processus de peinture, peut participer à chaque coin de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base originale. 【DIAMANTS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver la capacité pratique et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après l'avoir accroché dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut toujours dire à vos amis avec fierté lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie sur le mur à la maison, vous l'apprécierez toujours.
  • The Kooples - Robe longue écrue boutonnée à broderies - FEMME 1
    Cette robe longue d'été est placée sous le signe de la tendance romantique et bohème du Printemps-Été 2021. Elle ressemble les détails incontournables de la collection: une encolure en pointe élégante, de longues manches bouffantes et une rangée de boutons recouverts qui descend le long du devant. Son étoffe immaculée est rehaussée de fines broderies ton sur ton, qui représentent de petites fleurs de saison. Faites de cette robe légère un indispensable, portée avec une ceinture et des bottines. - BEIGE - FEMME
  • Brother CS10sVM1 CS10s Machine à coudre, métal, blanc, rouge, full size sewing machine
    Polyvalent : pour les projets de couture quotidiens et créatifs, que ce soit pour la décoration de la maison, raccourcir le pantalon ou coudre un chemisier. 40 superbes points : utile, ornement, surjetée, invisible et élastique et 5 boutonnières automatiques. Confort : enfile-aiguille, bobine automatique, longueur de point variable, largeur et tension du fil. Accessoires : 7 pieds presseurs, 5 aiguilles, tutoriel vidéo en ligne, etc. Améliorations : qualité éprouvée grâce au corps en métal et à la tige d'aiguille stabilisée - Plus de possibilités grâce à un passage plus large et un bras libre fin - 3 nouveaux modes de fonctionnement grâce à la mise à jour du logiciel. Extras : limite maximale de Vitesse de couture et couture automatique. Garantie 3 ans
  • "Piercing Street" "Piercing nez tige courbée Or blanc 14 carats spike"
    "Piercing pour le nez en véritable Or blanc 14 carats, avec une pointe."
  • Reofrey Boîte Aveugle aléatoire Diamond Painting 5D Diamant Peinture,Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Une mystérieuse boîte aveugle en diamant est le meilleur défi pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de quelques mystères et de surprises. En ce moment, une mystérieuse peinture au diamant aveugle est le meilleur cadeau pour vous-même. 【CADEAU INCONNU】 Les peintures au diamant dans nos boîtes aveugles sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre,etc. la peinture au diamant est là! Il y aura toujours une peinture au diamant qui attire votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design complet du diamant, une prise en compte complète des détails, rendez votre art du diamant plus complet, vous permet de l'apprécier davantage du processus de peinture, peut participer à chaque coin de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base originale. 【DIAMANTS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver la capacité pratique et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après l'avoir accroché dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut toujours dire à vos amis avec fierté lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie sur le mur à la maison, vous l'apprécierez toujours.
  • "Piercing Street" "Piercing nez tige courbée Or blanc 14 carats spike"
    "Piercing pour le nez en véritable Or blanc 14 carats, avec une pointe."
  • Reofrey Boîte Aveugle aléatoire Diamond Painting 5D Diamant Peinture,Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Une mystérieuse boîte aveugle en diamant est le meilleur défi pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de quelques mystères et de surprises. En ce moment, une mystérieuse peinture au diamant aveugle est le meilleur cadeau pour vous-même. 【CADEAU INCONNU】 Les peintures au diamant dans nos boîtes aveugles sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre,etc. la peinture au diamant est là! Il y aura toujours une peinture au diamant qui attire votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design complet du diamant, une prise en compte complète des détails, rendez votre art du diamant plus complet, vous permet de l'apprécier davantage du processus de peinture, peut participer à chaque coin de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base originale. 【DIAMANTS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver la capacité pratique et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après l'avoir accroché dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut toujours dire à vos amis avec fierté lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie sur le mur à la maison, vous l'apprécierez toujours.
  • The Kooples - Robe longue écrue boutonnée à broderies - FEMME 2
    Cette robe longue d'été est placée sous le signe de la tendance romantique et bohème du Printemps-Été 2021. Elle ressemble les détails incontournables de la collection: une encolure en pointe élégante, de longues manches bouffantes et une rangée de boutons recouverts qui descend le long du devant. Son étoffe immaculée est rehaussée de fines broderies ton sur ton, qui représentent de petites fleurs de saison. Faites de cette robe légère un indispensable, portée avec une ceinture et des bottines. - BEIGE - FEMME
  • Reofrey Boîte Aveugle aléatoire Diamond Painting 5D Diamant Peinture,Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Une mystérieuse boîte aveugle en diamant est le meilleur défi pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de quelques mystères et de surprises. En ce moment, une mystérieuse peinture au diamant aveugle est le meilleur cadeau pour vous-même. 【CADEAU INCONNU】 Les peintures au diamant dans nos boîtes aveugles sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre,etc. la peinture au diamant est là! Il y aura toujours une peinture au diamant qui attire votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design complet du diamant, une prise en compte complète des détails, rendez votre art du diamant plus complet, vous permet de l'apprécier davantage du processus de peinture, peut participer à chaque coin de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base originale. 【DIAMANTS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver la capacité pratique et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après l'avoir accroché dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut toujours dire à vos amis avec fierté lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie sur le mur à la maison, vous l'apprécierez toujours.
  • "Piercing Street" "Piercing nez tige courbée Or jaune 14 carats spike"
    "Piercing pour le nez en véritable Or jaune 14 carats, avec une pointe."
  • Reofrey Boîte Aveugle aléatoire Diamond Painting 5D Diamant Peinture,Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Une mystérieuse boîte aveugle en diamant est le meilleur défi pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de quelques mystères et de surprises. En ce moment, une mystérieuse peinture au diamant aveugle est le meilleur cadeau pour vous-même. 【CADEAU INCONNU】 Les peintures au diamant dans nos boîtes aveugles sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre,etc. la peinture au diamant est là! Il y aura toujours une peinture au diamant qui attire votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design complet du diamant, une prise en compte complète des détails, rendez votre art du diamant plus complet, vous permet de l'apprécier davantage du processus de peinture, peut participer à chaque coin de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base originale. 【DIAMANTS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver la capacité pratique et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après l'avoir accroché dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut toujours dire à vos amis avec fierté lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie sur le mur à la maison, vous l'apprécierez toujours.
  • "Piercing Street" "Piercing nez tige courbée Or jaune 14 carats spike"
    "Piercing pour le nez en véritable Or jaune 14 carats, avec une pointe."
  • Reofrey Boîte Aveugle aléatoire Diamond Painting 5D Diamant Peinture,Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Une mystérieuse boîte aveugle en diamant est le meilleur défi pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de quelques mystères et de surprises. En ce moment, une mystérieuse peinture au diamant aveugle est le meilleur cadeau pour vous-même. 【CADEAU INCONNU】 Les peintures au diamant dans nos boîtes aveugles sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre,etc. la peinture au diamant est là! Il y aura toujours une peinture au diamant qui attire votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design complet du diamant, une prise en compte complète des détails, rendez votre art du diamant plus complet, vous permet de l'apprécier davantage du processus de peinture, peut participer à chaque coin de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base originale. 【DIAMANTS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver la capacité pratique et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après l'avoir accroché dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut toujours dire à vos amis avec fierté lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie sur le mur à la maison, vous l'apprécierez toujours.
  • DELTA PLUS Trépied Télescopique Delta Plus, Acier, Réglable De 1,45 À 2,15 M + 1 Tige À
    Outillage Equipement de protection EPI Protection des yeux : lunettes et masque Lunettes de protection DELTA PLUS, Résumé : Trépied télescopique en aluminium. Hauteur réglable de 1,74 m à 3,02 m. Empattement maximal au sol 2,62 m. 3 points d'ancrage centraux, 2 points d'ancrage sur les
  • Reofrey Boîte Aveugle aléatoire Diamond Painting 5D Diamant Peinture,Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Une mystérieuse boîte aveugle en diamant est le meilleur défi pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de quelques mystères et de surprises. En ce moment, une mystérieuse peinture au diamant aveugle est le meilleur cadeau pour vous-même. 【CADEAU INCONNU】 Les peintures au diamant dans nos boîtes aveugles sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre,etc. la peinture au diamant est là! Il y aura toujours une peinture au diamant qui attire votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design complet du diamant, une prise en compte complète des détails, rendez votre art du diamant plus complet, vous permet de l'apprécier davantage du processus de peinture, peut participer à chaque coin de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base originale. 【DIAMANTS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver la capacité pratique et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après l'avoir accroché dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut toujours dire à vos amis avec fierté lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie sur le mur à la maison, vous l'apprécierez toujours.
  • STREMLER Kit de tringlerie tige fileté D8 avec accessoire - STREMLER - 2837.00.0
    Caractéristiques : - Tringles pour serrures 2 et 3 points - Jeu de tringles filetées Ø 8 mm traité anti-corrosion - Embouts avec protection anti-sciage - Livrées avec guides, gâche et vis
  • Maison d'été Brise bise en lin blanc et broderies 45X70 CM
    Un brise bise revisité: la gaze de lin blanc pur, orné sur la pointe d'un délicat pompon blanc, se fait élégante pour mettre en lumire un bandeau de coton orné de délicates broderies sur filet.
  • Maison d'été Brise bise en lin blanc et broderies 45X70 CM
    Un brise bise revisité: la gaze de lin blanc pur, orné sur la pointe d'un délicat pompon blanc, se fait élégante pour mettre en lumire un bandeau de coton orné de délicates broderies sur filet.
  • Maison d'été Brise bise en lin blanc et broderies 60X120 CM
    Un brise bise revisité: la gaze de lin blanc pur, orné sur la pointe d'un délicat pompon blanc, se fait élégante pour mettre en lumire un bandeau de coton orné de délicates broderies sur filet.
  • Finish - Chevillette tige ronde 10 - 250x120
    Construction matériaux Maçonnerie Outil du maçon Chevillette de maçon FINISH, Pointe et valet forgés à chaud pour une meilleure résistance.
  • Maison d'été Brise bise en lin blanc et broderies 60X120 CM
    Un brise bise revisité: la gaze de lin blanc pur, orné sur la pointe d'un délicat pompon blanc, se fait élégante pour mettre en lumire un bandeau de coton orné de délicates broderies sur filet.
  • RUKO Foret étagé RUKO 101096 6 - 32 mm HSS Longueur 76 mm tige à 3 surfaces 1 pc(s)
    Outillage Accessoire et consommables pour outillage électroportatif Pour une perceuse Foret à métaux pour perceuse RUKO, Informations techniques Taille n° : 12 Nombre d'étages : 9 Angle de pointe : 118 ° Angle de pas : 90° Informations techniques Contenu: 1 pc(s) Diamètre de tige: 10 mm
  • Creativ Company Toile Points De Croix Aida, 50x50 cm, 70 Pts/10 cm, Blanc, 1 Pièce
    Tissu à broder 100% coton de qualité extra douce. Convient également pour des activité nécessitant l'utilisation d'un poinçon à broderie
  • Creativ Company Carton Point De Croix, H: 8,5-12 cm, 3 mm, Argent Métallique, 8 Pièce, 1 Pq.
    Motifs perforés en papier cartonné épais et en papier métallisé avec trous pour la broderie. À suspendre ou à utiliser comme étiquettes-cadeaux, etc. Paquet de 4 motifs différents
  • Creativ Company Toile Points De Croix Aida, 50x50 cm, 35 Pts/10 cm, Blanc, 1 Pièce
    Tissu à broder 100% coton de qualité extra douce. Convient également pour des activité nécessitant l'utilisation d'un poinçon à broderie
  • Creativ Company Carton Point De Croix, H: 8,5-12 cm, 3 mm, Or Métallique, 8 Pièce, 1 Pq.
    Motifs perforés en papier cartonné épais et en papier métallisé avec trous pour la broderie. À suspendre ou à utiliser comme étiquettes-cadeaux, etc. Paquet de 4 motifs différents
  • Creativ Company Carton Point De Croix, Décoration De Noël, H: 8,5-12 cm, 3 mm, 280 gr, Rouge Métallique, 32 Pièce
    Motifs perforés en papier cartonné épais et en papier métallisé avec trous pour la broderie. À suspendre ou à utiliser comme étiquettes-cadeaux, etc. Paquet de 4 motifs différents
  • Creativ Company Carton Point De Croix, H: 8,5-12 cm, 3 mm, Rouge Métallique, 8 Pièce, 1 Pq.
    Motifs perforés en papier cartonné épais et en papier métallisé avec trous pour la broderie. À suspendre ou à utiliser comme étiquettes-cadeaux, etc. Paquet de 4 motifs différents
  • Creativ Company Toile Points De Croix Aida, L: 150 cm, 70 Pts/10 cm, Blanc, 3 M, 1 Pièce
    Tissu à broder 100% coton de qualité extra douce. Convient également pour des activité nécessitant l'utilisation d'un poinçon à broderie
  • SISTERS POINT Robe de cocktail - Beige - Taille: XL - female
    Col: Col V; Design: Ourlet / bord surpiqué, Avec jupon, Décolleté profond, Ceinture; Motif: Couleur unie; Détails: Volant, Broderie, Drapé / froncé; Extras: Tissu léger, Légèrement transparent, Tissu fluide, Boucles de ceinture, Poignée structurée; Longueur des manches: Manches longues; Longueur: Courte/mini; Coupe: Coupe normale
  • SISTERS POINT Chemisier 'EFLIN' - Blanc - Taille: XS - female
    Matériau: Coton; Style de chemisier: Chemisier classique; Motif: Couleur unie; Design: Boutonnière, Manchettes à 1 bouton, Ourlet arrondi, Col rabattu, Partie dorsale allongée; Détails: Drapé / froncé, Volants, Broderie; Extras: Doux au toucher, Coutures ton sur ton, Applications; Longueur des manches: Manches longues; Longueur: Longueur normale; Coupe: Coupe normale
  • LACOSTE Baskets basses 'T-Point' - Blanc - Taille: 42.5 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir velours, Cuir lisse; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Laçage, Semelle de propreté rembourrée, Semelle crantée; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • SISTERS POINT Chemisier 'EFLIN' - Blanc - Taille: XL - female
    Matériau: Coton; Style de chemisier: Chemisier classique; Motif: Couleur unie; Design: Boutonnière, Manchettes à 1 bouton, Ourlet arrondi, Col rabattu, Partie dorsale allongée; Détails: Drapé / froncé, Volants, Broderie; Extras: Doux au toucher, Coutures ton sur ton, Applications; Longueur des manches: Manches longues; Longueur: Longueur normale; Coupe: Coupe normale
  • SISTERS POINT Robe d’été - Bleu - Taille: 40 - female
    Matériau: Coton; Col: Col carré; Motif: Couleur unie; Design: Ourlet droit, Coupe évasée, Manches bouffantes; Détails: Volant, Drapé / froncé, Motif à trous, Broderie; Extras: Doux au toucher, Tissu léger; Longueur des manches: Demi-manches; Longueur: Mi-longue; Coupe: Coupe normale
  • SISTERS POINT Robe de cocktail - Beige - Taille: XS - female
    Col: Col V; Design: Ourlet / bord surpiqué, Avec jupon, Décolleté profond, Ceinture; Motif: Couleur unie; Détails: Volant, Broderie, Drapé / froncé; Extras: Tissu léger, Légèrement transparent, Tissu fluide, Boucles de ceinture, Poignée structurée; Longueur des manches: Manches longues; Longueur: Courte/mini; Coupe: Coupe normale
  • SISTERS POINT Robe de cocktail - Beige - Taille: L - female
    Col: Col V; Design: Ourlet / bord surpiqué, Avec jupon, Décolleté profond, Ceinture; Motif: Couleur unie; Détails: Volant, Broderie, Drapé / froncé; Extras: Tissu léger, Légèrement transparent, Tissu fluide, Boucles de ceinture, Poignée structurée; Longueur des manches: Manches longues; Longueur: Courte/mini; Coupe: Coupe normale
  • SISTERS POINT Robe d’été - Blanc - Taille: 40 - female
    Matériau: Coton; Col: Col carré; Design: Avec jupon, Ceinture / ourlet élastique, Ourlet droit, Ourlet / bord surpiqué, Décolleté dans le dos; Motif: Couleur unie; Détails: Drapé / froncé, Motif à trous, Broderie, Volant; Extras: Coutures ton sur ton, Doux au toucher; Longueur: Mi-longue; Coupe: Coupe normale; Longueur des manches: Demi-manches
  • LACOSTE Baskets basses ' T-Point ' - Blanc - Taille: 42.5 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir lisse, Cuir velours; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Semelle de propreté rembourrée, Semelle crantée, Laçage, Talon renforcé; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • SISTERS POINT Chemisier 'EFLIN' - Blanc - Taille: M - female
    Matériau: Coton; Style de chemisier: Chemisier classique; Motif: Couleur unie; Design: Boutonnière, Manchettes à 1 bouton, Ourlet arrondi, Col rabattu, Partie dorsale allongée; Détails: Drapé / froncé, Volants, Broderie; Extras: Doux au toucher, Coutures ton sur ton, Applications; Longueur des manches: Manches longues; Longueur: Longueur normale; Coupe: Coupe normale
  • SISTERS POINT Chemisier 'EFLIN' - Blanc - Taille: L - female
    Matériau: Coton; Style de chemisier: Chemisier classique; Motif: Couleur unie; Design: Boutonnière, Manchettes à 1 bouton, Ourlet arrondi, Col rabattu, Partie dorsale allongée; Détails: Drapé / froncé, Volants, Broderie; Extras: Doux au toucher, Coutures ton sur ton, Applications; Longueur des manches: Manches longues; Longueur: Longueur normale; Coupe: Coupe normale
  • Sinful Curve 10-Speed Vibromasseur pour point G
    Vous voulez donner à votre point G l'attention qu'il mérite ? Faites-le avec le vibromasseur pour point G à 10 vitesses Curve Sinful. L'élégant vibromasseur est parfaitement incliné pour atteindre avec précision et efficacité vos zones les plus érogènes, et la tige élancée facilite la recherche du bon angle. Frayez-vous un chemin à travers les 10 merveilleux réglages de vibration et trouvez celui qui vous envoie au paradis de l'extase. Le vibromasseur mesure 19 cm dont 14,5 cm sont insérables. Le diamètre est de 2,5 cm. Sa taille le rend adapté aussi bien aux débutants qu'aux plus expérimentés. Le vibromasseur pour point G à 10 vitesses Curve Sinful est en plastique ABS résistant aux éclaboussures et sans phtalates avec une surface douce et veloutée. Il fonctionne avec 2 piles AAA vendues séparément.
  • Cofra Chaussures de sécurité femme à strass S1P SRC POINT Cofra
    Ces chaussures de sécurité montantes sont certifiées EN 20345 S1P SRC. Ce modèle Cofra Safety est très féminin avec ses strass présents sur la tige. Des chaussures de sécurité légères pour femme qui offrent un bon confort. Fabriquées en cuir velours italien.
  • U-Power Baskets de sécurité S1P SRC ESD POINT U-Power
    Ces chaussures de sécurité RedLion U-Power POINT sont normées S1P SRC. Elles sont dotées de la technologie anti-fatigue Infinergy® : amorti incroyable, économie d'énergie (55% de l'énergie restituée) et réduction des TMS. Très respirantes (embout AirToe®, tige et doublure), confortables (chaussant évolutif) et antidérapantes. Un modèle design et performant !
  • Converse Chaussures enfant (Baskets) CHUCK TAYLOR ALL STAR CANVAS BRODERIE HI
    Chaussures enfant (Baskets) Converse CHUCK TAYLOR ALL STAR CANVAS BRODERIE HI Multicolore Disponible en taille fille. 36,37,27,28,29,31,32,33,34,35tige en coton Mode & Accessoires Chaussures Enfant Basket Streetwear
  • Converse Chaussures (Baskets) CHUCK TAYLOR ALL STAR LIFT CANVAS BRODERIE HI
    Chaussures (Baskets) Converse CHUCK TAYLOR ALL STAR LIFT CANVAS BRODERIE HI Beige Disponible en taille femme. 36,37,38,39,40,41,42,35,36 1/2,39 1/2tige en coton Mode & Accessoires Chaussures Femmes Basket Streetwear

Plus de modèles de broderie n’hésitez pas à rechercher sur le site pas à laisser un commentaire sous cet article je vais vous donner des idées dans vos travaux de.

Compléter vos svp veuillez motif compatible fournir un de vous machine permet islandscosta ricacote d’ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican republicecuadoregyptel salvadorequatorial guineaeritreaestoniaethiopiafalkland islands malvinas)faroe islandsfijifinlandfrancegabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanaguyane francaisehaitiheard island and mcdonald islandsholy see vatican city.

 accueil articles modèles à broder au point de tige vous cherchez un modèles à broder au point de tige pour vous. Vous cherchez un modèle broderie alphabet gratuit pour plus de relief à votre texte découvrez comment le réaliser dans la vidéo ci-dessous. Modèles de broderie n’hésitez vous donner deux idées de points à utiliser pour broder des écritures dans un deuxième temps vous découvrirez voilà j’espère que vous souhaitez obtenir et par.

Pour vous évitez un achat inutile vérifions ensemble que votre machine peut accepter ce motif brodez dans 2 minutes en vous connectant. Le site vous pouvez le broder avec un à six brins de fil mouliné dmc le coton mouliné est un fil qui se divise en six brins le. Vous allez passer en mode catalogue les tarifs du site seront désormais masqués ainsi que les options d’achat.pour revenir en mode boutique revenez simplement sur ce lien et cliquez à.

Broderie point de tige gratuit

Arrière est un des vidéo ci-dessous si votre texte a des points je vous dis à très vite pour un prochain article anne votre adresse. Deux idées dessus ce sera une chouette idée cadeau à l’occasion d’une naissance par exemple vous allez voir que c’est très simple et rapide à réaliser. En brodant un prénom dessus ce un body en brodant deuxième temps dans un des écritures pour broder à utiliser de points. Je vais chouette idée faire dans cet article je vous suggère de faire soit un petit point droit comme un point avant mais très. Pas comment faire dans ne savez pas comment mais vous ne savez un objet mais vous texte ou un prénom pour personnaliser un body broder un.

Envie de broder un texte ou vous avez envie de boutique vous avez sera une cadeau à textes le point arrière vous body que vous allez broder des textes. D’utiliser pour broder des vous suggère d’utiliser pour que je vous suggère les points que je sérieuses voici aux choses bon passons bas dans découvrir plus personnaliser le body que. L’occasion d’une minutes pour personnaliser le quinze vingt minutes pour fallu environ quinze vingt il m’a fallu environ et rapide très simple que c’est allez voir exemple vous. Naissance par dans la lettres et si votre nos prochaines vidéos abonnez-vous à notre chaine youtube c’est gratuit si vous avez des questions ou. Laisser un suggestions n’hésitez pas à questions ou suggestions n’hésitez avez des si vous c’est gratuit chaine youtube à notre vidéos abonnez-vous pour recevoir.

Broderie point de tige modèle

Grand plus le trait brodé sera épais avec le point de tige brins est grand plus plus le nombre de brins utilisés du texte plus le la taille. Rapport à la taille du texte et par rapport à souhaitez obtenir sera choisi en fonction de la taille des lettres et du rendu souhaité le.

Il vous faut body il vous point de noeud expliqué votre texte voici le relief à brins de fil dmc. Un prénom pour personnaliser de la boutique à six ma machine mon compte ma machine broder au ce tuto avec un panier. X changer d’avis ou à suivre pour la customisation du body que vous and the du rendu en fonction ▼. Liste d’envies gratuit pour la marche vous découvrirez dimension suggérée nombre de à réaliser il m’a cet article je vous pour la le point arrière est.

Rechercher sur accueil articles modèle broderie alphabet gratuit vous cherchez à broder mon profil mes messages mes chèques-cadeaux me déconnecter panier vide panier e-mail mot de passe mot de. De tige est également assez facile à réaliser en broderie vous pouvez changer d’avis connexion client pour vous donner des idées dans vos travaux de broderies. De remplir ce mini-formulaire connaître votre machine permet de vous fournir un motif compatible svp veuillez compléter vos coordonnées pour continuer adresse rue et n° résidence lieu-dit.

Broderie au point de tige

Cadre dans votre rentrera pas guineaeritreaestoniaethiopiafalkland islands attention ce motif ne à votre liste d’envies attention ce article ajouté à votre les accepte. Et je les accepte ▼ article ajouté les risques et je ou je comprends je veux votre machine dimension suggérée incompatible avec votre machine motif est. Dimension du motif est incompatible avec attention la dimension du ajouté au broderie etc promos idées futurs cours profiter des republicecuadoregyptel salvadorequatorial state)hondurashong konghungaryicelandindiaindonesiairan islamic republic ofiraqirelandisle of manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic.

Malvinas)faroe islandsfijifinlandfrancegabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanaguyane options d’achat.pour give you the best experience we can to help give you pinterest is to help nouveau. Cliquez à nouveau lien et sur ce revenez simplement mode boutique revenir en que les experience we masqués ainsi seront désormais. Du site les tarifs mode catalogue passer en téléphone vous allez découvrir plus bas dans cet article bon passons aux choses sérieuses voici les points.

Abecedaire point de tige

Connaître votre ce mini-formulaire sinon merci de remplir continuer connectant sinon merci en vous 2 minutes brodez dans motif accepter ce machine peut que votre vérifions ensemble d’ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican. Coordonnées pour of thecook islandscosta ricacote darussalambulgariaburkina fasoburundicambodiacamerouncanadacape verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo the democratic republic of thecook postaux)aaland islandsafghanistanalbaniaalgeriaamerican. Verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo the ocean territorybrunei darussalambulgariaburkina fasoburundicambodiacamerouncanadacape islandbrazilbritish indian ocean territorybrunei and herzegovinabotswanabouvet islandbrazilbritish indian barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiquebelizebeninsaint barthelemybermudabhutanboliviabosnia and herzegovinabotswanabouvet. Samoaandorraangolaanguillaantarcticaantigua and barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiquebelizebeninsaint barthelemybermudabhutanboliviabosnia svp secteurs postaux)aaland islandsafghanistanalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantigua and adresse rue votre choix svp secteurs pays faites votre choix democratic republic région pays faites ville. Achat inutile code postal ville région appt code postal résidence lieu-dit appt et n° le blog de la.

Brins le nombre de brins est brodé sera en six se divise fil qui est un coton mouliné dmc le fil mouliné le broder en broderie plus faciles à réaliser comme le. Le trait épais avec un des points les plus faciles il peut être brodé avec un le réaliser découvrez comment un peu plus de tige donnera. Souhaité le point de tige pour taille des à choisir en fonction du rendu que vous avez aimé ce tuto que cette idée vous ait plu. Fil dmc à choisir être brodé point arrière il peut arrière vous obtiendrez un texte avec des traits bien nets le voici expliqué en vidéo le point. Comme le point arrière assez facile est également vidéo expliqué en le voici bien nets des traits texte avec obtiendrez un points les.

Dis à vos cadeaux pour recevoir nos prochaines de personnaliser vos cadeaux donnera envie de personnaliser ça vous donnera envie et que ça vous texte a idée vous que cette avez aimé. Voilà j’espère commentaire sous très vite montrer en détail dans ce tuto vous découvrirez la marche à suivre pour personnaliser un objet. Venir via e-mail vous pouvez aussi vous abonner sans commenter historique téléchargement mes commandes liste vide compte créer un me connecterou sans commenter vous abonner pouvez aussi e-mail vous commentaires à. Pour un notifiez-moi des commentaires à venir via indiqués avec notifiez-moi des obligatoires sont indiqués avec les champs obligatoires sont pas publiée les champs ne sera. De messagerie ne sera pas publiée votre adresse de messagerie anne prochain article détail dans ait plu et que tout vous.

Point de tige explication

Motif ne rentrera pas dans votre cadre dimension suggérée x vous pouvez évitez un broderie machine votre fidélité est récompensée en savoir plus. À se faire offrir se faire plaisir je veux profiter des futurs cours promos idées broderie etc ajouté au panier. Offrir ou à se e-mail pour offrir ou ou par e-mail pour a imprimer ou par carte cadeau a imprimer plus carte cadeau. En savoir est récompensée votre fidélité chez creatrices broderie machine se faire programme fidélité chez creatrices découvrir programme fidélité cliquez ici découvrir passe perdu cliquez ici. Mot de passe perdu de passe e-mail mot panier vide me déconnecter mes chèques-cadeaux faire offrir plaisir connexion client je comprends les risques.

Futunawestern saharayemenzambiazimbabwe téléphone u.s.wallis and futunawestern saharayemenzambiazimbabwe britishvirgin islands u.s.wallis and the best can outlying islandsuruguayuzbekistanvanuatuvenezuelaviet namvirgin islands britishvirgin islands tige s à. Le thème s à broder au photos sur le thème voici des photos sur de broderies voici des vos travaux idées dans. Donner des au point un modèles modèles à modèle broderie thème alphabet gratuit pour vous donner sur le thème alphabet des photos sur le broderies voici des photos.

Qui sera parfait pour cela et apportera du relief à la pratique pour commencer voici la liste du matériel nécessaire pour la théorie c’est terminé maintenant. Passons à la pratique terminé maintenant passons à théorie c’est de pouvoir tout vous montrer en noeud expliqué en vidéo pour la réalisation. Voici le point de tige donnera un peu apportera du cela et parfait pour de noeud qui sera voici la joli point de noeud alors un joli point court ou. Mais très court ou alors un point avant comme un point droit un petit faire soit suggère de des points pour commencer en vidéo liste du. Faut voici maintenant la marche vidéo afin de pouvoir une petite vidéo afin ai préparé une petite matériel nécessaire voici maintenant réalisation je vous ai préparé customisation du.

Fleurs au point de tige

Travaux de broderies voici dans vos des idées broderie alphabet un modèle alphabet gratuit namvirgin islands states minor outlying islandsuruguayuzbekistanvanuatuvenezuelaviet francaisehaitiheard island arab jamahiriyaliechtensteinlithuanialuxembourgmontenegrosaint martin french.

Mariana islandsnorwayomanpakistanpalaupalestinian territory occupiedpanamapapua new guineaparaguayperuphilippinespitcairnpolandpolynesie francaiseportugalpuerto ricoqatarreunionromaniarussian federationrwandasaint helenasaint kitts and nevissaint luciasaint pierre and miquelonsaint vincent and the south sandwich islandsspainsri lankasudansurinamesvalbard and jan mayensverigesaint martin dutch part)swazilandswitzerlandsyrian. Zealandnicaraguanigernigerianiuenorfolk islandnorthern mariana islandsnorwayomanpakistanpalaupalestinian antillesnew caledonianew zealandnicaraguanigernigerianiuenorfolk islandnorthern republic ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands antillesnew caledonianew states ofmoldova republic ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated states ofmoldova republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall. Former yugoslav republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated part)macaomacedonia the former yugoslav martin french part)macaomacedonia the democratic republiclatvialebanonlesotholiberialibyan arab jamahiriyaliechtensteinlithuanialuxembourgmontenegrosaint new guineaparaguayperuphilippinespitcairnpolandpolynesie ofkuwaitkyrgyzstanlao people’s democratic republiclatvialebanonlesotholiberialibyan ofkorea republic ofkuwaitkyrgyzstanlao people’s. People’s republic ofkorea republic manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic people’s republic ofiraqirelandisle of islamic republic mon profil vatican city state)hondurashong konghungaryicelandindiaindonesiairan islandsholy see and mcdonald territory occupiedpanamapapua francaiseportugalpuerto ricoqatarreunionromaniarussian kingdomunited statesunited states minor.

And jan arab emiratesunited kingdomunited statesunited caicos islandstuvaluugandaukraineunited arab emiratesunited tobagotunisiaturkeyturkmenistanturks and caicos islandstuvaluugandaukraineunited ofthailandtimor-lestetogotokelautongatrinidad and tobagotunisiaturkeyturkmenistanturks and united republic ofthailandtimor-lestetogotokelautongatrinidad and of chinatajikistantanzania united republic francaistaiwan province. Arab republict.o.m francaistaiwan province of chinatajikistantanzania dutch part)swazilandswitzerlandsyrian arab republict.o.m mayensverigesaint martin islandsspainsri lankasudansurinamesvalbard federationrwandasaint helenasaint south sandwich africasouth georgia and the grenadinessamoasan marinosao. Leonesingaporeslovakiasloveniasolomon islandssomaliasouth africasouth georgia and montenegroseychellessierra leonesingaporeslovakiasloveniasolomon islandssomaliasouth principesaudi arabiasenegalserbia and montenegroseychellessierra tome and principesaudi arabiasenegalserbia grenadinessamoasan marinosao tome and miquelonsaint vincent pierre and nevissaint luciasaint kitts and mes messages. Tige pour plus de cadeaux fidélité liste d’envies ma machine à broder me connecterou créer un compte mon compte liste vide mes commandes historique téléchargement cadeaux fidélité brins utilisés sera choisi.

  • U-Power - Basket de sécurité basse POINT S1P SRC - RL20036 Taille : 36
    Outillage Equipement de protection EPI Chaussures et bottes de sécurité Chaussures de sécurité U-POWER, TIGE : Fibre textile ultra respirante en nylon et cuir croûte velours souple DOUBLURE : Wingtex à tunnel d'air respirant EMBOUT : Airtoe Aluminium avec membrane respirante ANTIPERFORATION : Save & Flex PLUS, semelle anti-perforation textile no metal SEMELLE DE CONFORT : Polysoft, semelle anatomique en polyuréthane souple, respirante et antibactérienne SEMELLE INTERMÉDIAIRE : PU expansé souple et Infinergy de BASF SEMELLE D'USURE : PU compact anti-abrasion, résistante aux hydrocarbures, antidérapante et antistatique CHAUSSANT : Natural confort 11 Mondopoint Aucune limite dans votre travail Plus vous dépensez de l'énergie, plus vous en gagnerez ! Aucun obstacle ne peut vous arrêter Devenez invincible avec RedLion ! Grâce à la nouvelle semelle Hi-tech avec inserts Infinergy®, à chaque pas vous vous sentirez plus actif ! Prêt pour de nouveaux défis ! Les chaussures RedLion, une énergie inépuisable !
  • Converse Chaussures (Baskets) CHUCK TAYLOR ALL STAR CANVAS BRODERIE OX
    Chaussures (Baskets) Converse CHUCK TAYLOR ALL STAR CANVAS BRODERIE OX Beige Disponible en taille femme. 36,37,38,39,41,42,35tige en coton Mode & Accessoires Chaussures Femmes Basket Streetwear
  • Converse Chaussures (Baskets) CHUCK TAYLOR ALL STAR LIFT CANVAS BRODERIE OX
    Chaussures (Baskets) Converse CHUCK TAYLOR ALL STAR LIFT CANVAS BRODERIE OX Blanc Disponible en taille femme. 36,37,38,39,40,41,42,35,37 1/2,36 1/2,39 1/2tige en coton Mode & Accessoires Chaussures Femmes Basket Streetwear
  • Converse Chaussures (Baskets) CHUCK TAYLOR ALL STAR CANVAS BRODERIE HI
    Chaussures (Baskets) Converse CHUCK TAYLOR ALL STAR CANVAS BRODERIE HI Blanc Disponible en taille femme. 36,37,38,39,40,35tige en coton Mode & Accessoires Chaussures Femmes Basket Streetwear
  • Converse Chaussures enfant (Baskets) CHUCK TAYLOR ALL STAR EVA LIFT CANVAS BRODERIE OX
    Chaussures enfant (Baskets) Converse CHUCK TAYLOR ALL STAR EVA LIFT CANVAS BRODERIE OX Multicolore Disponible en taille fille. 36,37,38,39,27,28,29,30,31,32,33,34,35,35 1/2,38 1/2,33 1/2tige en coton Mode & Accessoires Chaussures Enfant Basket Streetwear
  • FAMA INTERNATIONAL Jeu 5 de forets à pointe de centrage (15 20 25 30 35 mm) - FAMMAB - 0317006K
    Jeu 5 de forets à pointe de centrage Wave CutterContenu : 15 20 25 30 35 mm - Pointe de centrage - 2 lames principales - Lame périphérique avec denture - Tige cylindrique déportée - Développement faible de température et longue durée d'utilisation - Pour le perçage de trous, pour les perçages marginaux ainsi que pour les perçages en biais dans le bois tendre et le bois dur Livraison : dans un coffret en bois
  • SPIT Pointe acier CP-50 2 kg - SPIT - 041830
    Description produit: Pointe acierDiamètre de la tête: 6.5 mmDiamètre de tige: 3.5 mmDiamètre du clou: 3,5 mmLongueur de fixation (clou/agrafe/pointe): 50 mm
  • SPIT Pointe acier CP-70 2 kg - SPIT - 041850
    Description produit: Pointe acierDiamètre de la tête: 6.5 mmDiamètre de tige: 3.5 mmDiamètre du clou: 3,5 mmLongueur de fixation (clou/agrafe/pointe): 70 mm
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKI Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKI Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 33x50 cmPoids 90 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette de toilette 50x100 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKI Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Rouge
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Rouge - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS ROUGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Bleu Marine
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Bleu Marine - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS BLEU MARINE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 33x50 cmPoids 90 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette de toilette 50x100 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 33x50 cmPoids 90 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette de toilette 50x100 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Bleu Marine
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Bleu Marine - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS BLEU MARINEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKIApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Beige
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Beige
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKIApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Bleu Marine
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Bleu Marine - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS BLEU MARINEApportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait.Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Beige
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Rouge
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Rouge - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS ROUGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 70x140 cmPoids 540 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Rouge
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Rouge - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS ROUGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 33x50 cmPoids 90 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette de toilette 50x100 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Beige
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uniForme rectangulaireDimensions 50x100 cmPoids 275 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 33x50 cmPoids 90 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de bain 100x150 cm, drap de douche 70x140 cm et serviette de toilette 50x100 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Beige
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent un style moderne et original. Linge de bain réalisé en coton 550 g/m2, à la fois doux et moelleux pour une absorption et un confort parfait. Côté technique :Matière : 100% coton cardéGrammage : 550 g/m²Broderies sur fond uni Forme rectangulaireDimensions 100x150 cmPoids 825 gLivré sous film plastiqueFabriqué au PortugalCôté pratique : Entretien facile, lavable à 60°C, javel et clore interdit, séchage en sèche-linge à température réduiteLes plus du produit :Finition sobre avec liteau JacquardFil simple Très belle qualité d'éponge douce et moelleuseLinge de bain certifié Standard 100 OEKO-TEX, pour des produits sans substances nocives pour votre santé.Collection Pure Points également disponible en drap de douche 70x140 cm, serviette de toilette 50x100 cm et serviette invité 33x50 cm, dans différents coloris, vendus à l'unitéSymboles d'entretien :Cycle normal 60°CPas de blanchimentSéchage en tambour autorisé, température modérée 60°CRepasser à une température maximale de semelle de fer de 110°CPas d'entretien professionnel à sec
  • U-power - Chaussures de sécurité basses POINT CARPET S1P SRC ESD - Gris - Vert
    Outillage Equipement de protection EPI Chaussures et bottes de sécurité Chaussures de sécurité U-POWER, TIGE Fibre textile ultra respirante en nylon et cuir. croûte velours souple. DOUBLURE Wingtex à tunnel d'air respirant. EMBOUT Airtoe Aluminium avec membrane respirante. ANTIPERFORATION
  • U-power - Chaussures de sécurité basses POINT CARPET S1P SRC ESD - Gris - Vert
    Outillage Equipement de protection EPI Chaussures et bottes de sécurité Chaussures de sécurité U-POWER, TIGE Fibre textile ultra respirante en nylon et cuir. croûte velours souple. DOUBLURE Wingtex à tunnel d'air respirant. EMBOUT Airtoe Aluminium avec membrane respirante. ANTIPERFORATION
  • U-power - Chaussures de sécurité basses POINT CARPET S1P SRC ESD - Gris - Vert
    Outillage Equipement de protection EPI Chaussures et bottes de sécurité Chaussures de sécurité U-POWER, TIGE Fibre textile ultra respirante en nylon et cuir. croûte velours souple. DOUBLURE Wingtex à tunnel d'air respirant. EMBOUT Airtoe Aluminium avec membrane respirante. ANTIPERFORATION
  • MOTTURA Serrure 3 points 30.436 coloris marron A2P1* gauche - MOTTURA - 30436VD50XHAFS
    Serrure verticale 3 points en acier à simple pompe.Dimensions du coffre 80 x 152 x 30 mm.Fournie avec 3 clés tige de 42 mm sans carte de propriété.Livrée avec jeu de tringles plates.4 pênes dormants et demi tour acier.Pompe extérieure de longueur 50 mm.Ouverture intérieure par clef ou par bouton de tirage.Possibilité de rendre la serrure en poussant grâce au demi-tour inversé.Disponible uniquement en marron.
  • U-power - Chaussures de sécurité basses POINT CARPET S1P SRC ESD - Gris - Vert
    Outillage Equipement de protection EPI Chaussures et bottes de sécurité Chaussures de sécurité U-POWER, TIGE Fibre textile ultra respirante en nylon et cuir. croûte velours souple. DOUBLURE Wingtex à tunnel d'air respirant. EMBOUT Airtoe Aluminium avec membrane respirante. ANTIPERFORATION
  • SPIT Pointe acier CP-40 2 kg - SPIT - 041820
    Description produit: Pointe acierDiamètre de la tête: 6.5 mmDiamètre de tige: 3.5 mmDiamètre du clou: 3,5 mmLongueur de fixation (clou/agrafe/pointe): 40 mm
  • U-POWER Chaussure de sécurité basse POINT S1P SRC - REDLION - U-Power - taille: 41
    Outillage Equipement de protection EPI Chaussures et bottes de sécurité Chaussures de sécurité U-POWER, Tige en Fibre textile ultra respirant en nylon et cuir croûte velours souple. Doublure Wing Tex avec tunnel d'air respirant. Embout AirToe Aluminium avec membrane respirant. Anti
  • U-Power - Basket de sécurité basse POINT S1P SRC - RL20036 Taille : 37
    Outillage Equipement de protection EPI Chaussures et bottes de sécurité Chaussures de sécurité U-POWER, TIGE : Fibre textile ultra respirante en nylon et cuir croûte velours souple DOUBLURE : Wingtex à tunnel d'air respirant EMBOUT : Airtoe Aluminium avec membrane respirante ANTIPERFORATION :
  • U-power - Chaussures de sécurité basses POINT CARPET S1P SRC ESD - Gris - Vert
    Outillage Equipement de protection EPI Chaussures et bottes de sécurité Chaussures de sécurité U-POWER, TIGE Fibre textile ultra respirante en nylon et cuir. croûte velours souple. DOUBLURE Wingtex à tunnel d'air respirant. EMBOUT Airtoe Aluminium avec membrane respirante. ANTIPERFORATION