Alphabet Broderie Point De Tige

  • Lioninox Crochet inox en forme de tige "s" double sans pointe
    Crochets inox Ferrailles inox Hauteur (mm): 100 E (mm): 39 D (mm): 5
  • Riolis RI-1123 Kit de Broderie au Point de Croix Naissance Fille Rose
    La toile Zweigart Aïda blanche 5.5 points/cm Les fils Anchor 10 couleurs Le diagramme en couleurs Une aiguille Les explications en Français, Russe, Anglais, Allemand, Espagnole et Italien. Création de Anna Korol Couleur: Rose
  • Silex Jeu de mèches Tige SDS, pointe en métal dur 4 - 12 mm 56 pièces
    Pour Un Perçage Précis Et Contrôlé Dans La Maçonnerie, La Pierre Naturelle Et Le Béton Longue Durée De Vie Grâce à La Pointe En Métal Dur Transmission Directe De La Puissance Au Point De Forage Pour Utilisation Dans Les Marteaux-piqueurs Et Perceuses à Percussion Grande Stabilité De Forage Coupant à Droite Contenu De La Livraison : 3 Forets De Percussion ø 8 mm, 210 mm 3 Forets De Percussion ø 10 mm, 210 mm 5 Forets De Percussion ø 5 mm, 160 mm 5 Forets De Percussion ø 6 mm, 160 mm 5 Forets De Percussion ø 8 mm, 160 mm 5 Forets De Percussion ø 10 mm, 160 mm 5 Forets De Percussion ø 12 mm, 160 mm 5 Forets De Percussion ø 4 mm, 110 mm 10 Forets De Percussion ø 5 mm, 110 mm 10 Forets De Percussion ø 6 mm, 110 mm - Silex - Jeu De Mèches Tige Sds, Pointe En Métal Dur 4 - 12 Mm 56 Pièces
  • kuamai Patchs créatifs 26 Lettres Broderie Batch Back Alphabet Blanche Coudre Le Fer sur Patchs Badges brodés pour Sac Jeans Chapeau t-Shirt DIY Appliques Craft pour la décoration
    Patchs de bricolage, formes amusantes et conceptions, définitivement un large choix de possibilités de repasser sur votre point de choix Chacun de ces correctifs est idéal pour tout projet.Vestes, sacs, sacs à dos, vêtements pour hommes et femmes, uniformes scolaires, des réparations de couture, des jeans et de nombreux autres projets de bricolage. Pour appliquer les lettres, vous aurez juste besoin de votre morceau de tissu souhaité et d'un fer à repasser.Placez le fer à repasser sans tige et laissez-le sur le chiffre pendant environ 1 minute avec une pression légère.Vous êtes prêt à partir, vous pouvez cousir le numéro sur une attente supplémentaire. DIY PATCHES: Peut utiliser le patch pour personnaliser certains articles de vos cadeaux parfaits pour une fille, petite-fille, nièce lors de l'anniversaire, de l'école, de Noël, du nouvel an. Nous garantit la qualité de chaque pièce que nous envoyons.Si vous êtes du tout insatisfait pour une raison quelconque, contactez-nous et nous vous rembourserons ou remplacerons votre produit!
  • Diamond Point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 13 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Vervaco Kit au point compté Partie de naissance
    Kit broderie au point compté avecDiagramme Toile à broder: 100% coton Fil: 100% coton DMC Aiguille Carte deFils Instructions dans huit langues Diagramme agrandi Aïda Avec alphabet
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Reofrey Surprendre Aléatoire Diamond Painting 5D Diamant Peinture, Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale FF2562
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Un diamant mystérieux est le meilleur défi chanceux pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de mystères et de surprises. À cette époque, une mystérieuse peinture au diamant est le meilleur cadeau pour vous-même 【CADEAU INCONNU】 Les peintures au diamant sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre, de coucher de soleil, etc. La peinture au diamant est là! Il y aura toujours une peinture au diamant qui attirera votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design en diamant complet, une prise en compte complète des détails, rend votre art du diamant plus complet, vous permet de profiter davantage du processus de peinture, peut participer à tous les coins de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base d'origine. 【DIAMONDS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver les capacités pratiques et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après avoir été suspendu dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut également dire fièrement à vos amis lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie au mur à la maison, vous l'apprécierez toujours.
  • Diamond Point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 14 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Reofrey Surprendre Aléatoire Diamond Painting 5D Diamant Peinture, Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale FF14
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Un diamant mystérieux est le meilleur défi chanceux pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de mystères et de surprises. À cette époque, une mystérieuse peinture au diamant est le meilleur cadeau pour vous-même 【CADEAU INCONNU】 Les peintures au diamant sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre, de coucher de soleil, etc. La peinture au diamant est là! Il y aura toujours une peinture au diamant qui attirera votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design en diamant complet, une prise en compte complète des détails, rend votre art du diamant plus complet, vous permet de profiter davantage du processus de peinture, peut participer à tous les coins de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base d'origine. 【DIAMONDS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver les capacités pratiques et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après avoir été suspendu dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut également dire fièrement à vos amis lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie au mur à la maison, vous l'apprécierez toujours.
  • Diamond Point Collier en or blanc Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Reofrey Surprendre Aléatoire Diamond Painting 5D Diamant Peinture, Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale FF13
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Un diamant mystérieux est le meilleur défi chanceux pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de mystères et de surprises. À cette époque, une mystérieuse peinture au diamant est le meilleur cadeau pour vous-même 【CADEAU INCONNU】 Les peintures au diamant sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre, de coucher de soleil, etc. La peinture au diamant est là! Il y aura toujours une peinture au diamant qui attirera votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design en diamant complet, une prise en compte complète des détails, rend votre art du diamant plus complet, vous permet de profiter davantage du processus de peinture, peut participer à tous les coins de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base d'origine. 【DIAMONDS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver les capacités pratiques et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après avoir été suspendu dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut également dire fièrement à vos amis lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie au mur à la maison, vous l'apprécierez toujours.
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Reofrey Surprendre Aléatoire Diamond Painting 5D Diamant Peinture, Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale FF2563
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Un diamant mystérieux est le meilleur défi chanceux pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de mystères et de surprises. À cette époque, une mystérieuse peinture au diamant est le meilleur cadeau pour vous-même 【CADEAU INCONNU】 Les peintures au diamant sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre, de coucher de soleil, etc. La peinture au diamant est là! Il y aura toujours une peinture au diamant qui attirera votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design en diamant complet, une prise en compte complète des détails, rend votre art du diamant plus complet, vous permet de profiter davantage du processus de peinture, peut participer à tous les coins de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base d'origine. 【DIAMONDS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver les capacités pratiques et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après avoir été suspendu dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut également dire fièrement à vos amis lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie au mur à la maison, vous l'apprécierez toujours.
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Reofrey Surprendre Aléatoire Diamond Painting 5D Diamant Peinture, Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale FF2566
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Un diamant mystérieux est le meilleur défi chanceux pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de mystères et de surprises. À cette époque, une mystérieuse peinture au diamant est le meilleur cadeau pour vous-même 【CADEAU INCONNU】 Les peintures au diamant sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre, de coucher de soleil, etc. La peinture au diamant est là! Il y aura toujours une peinture au diamant qui attirera votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design en diamant complet, une prise en compte complète des détails, rend votre art du diamant plus complet, vous permet de profiter davantage du processus de peinture, peut participer à tous les coins de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base d'origine. 【DIAMONDS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver les capacités pratiques et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après avoir été suspendu dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut également dire fièrement à vos amis lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie au mur à la maison, vous l'apprécierez toujours.
  • Diamond Point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 14 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Reofrey Surprendre Aléatoire Diamond Painting 5D Diamant Peinture, Mystérieux DIY Cristal Strass Peinture Plein Forage Broderie Artisanat Point De Croix Chambre Salon Décoration Murale FF19
    【LA VIE A BESOIN DE SURPRISES】 Vous ne pouvez pas être sûr du type de peinture au diamant inclus dans l'emballage. Un diamant mystérieux est le meilleur défi chanceux pour vous, un test de votre chance. Lorsque notre vie est ennuyeuse, nous avons besoin de mystères et de surprises. À cette époque, une mystérieuse peinture au diamant est le meilleur cadeau pour vous-même 【CADEAU INCONNU】 Les peintures au diamant sont toutes emballées individuellement. Vous pouvez recevoir des peintures au diamant de n'importe quel motif, il peut s'agir de lettres de l'alphabet, de ciel étoilé, de phares, de tournesols, de fleurs, de paon, de café ou même de portraits de femmes exotiques, de paysages, de chat, de crâne, de fille, de tigre, de coucher de soleil, etc. La peinture au diamant est là! Il y aura toujours une peinture au diamant qui attirera votre cœur. 【FULL DRILL】 L'art du diamant 5D avec un design en diamant complet, une prise en compte complète des détails, rend votre art du diamant plus complet, vous permet de profiter davantage du processus de peinture, peut participer à tous les coins de l'image. 20 sections carrées au-dessus des forets ronds pour un aspect brillant et l'image finie formera un effet tridimensionnel sur la base d'origine. 【DIAMONDS ART】 - Nos peintures au diamant peuvent vous fournir une toile de dessin imaginative, adaptée à tous les âges, tout le monde peut devenir designer. Cela peut aider les personnes âgées à passer du temps, à cultiver les capacités pratiques et la patience des enfants et à détendre votre vie. 【DÉCORATION UNIQUE】 - Vous pouvez décorer votre maison. Peut monter le produit fini après avoir été suspendu dans le salon, le bureau, la chambre à coucher pour ajouter une saveur artistique, peut également dire fièrement à vos amis lorsqu'ils visitent votre maison, "Ceci est mon œuvre d'art!". Accrochez votre peinture au diamant finie au mur à la maison, vous l'apprécierez toujours.
  • Diamond Point Collier en or blanc 0,02 ct diamant Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.) Et est serti de 11 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Kamaca Kit de broderie - 80 x 80 cm - Motif rouge-gorge - Point de tige, passé plat, broderie aiguilletée - Préimprimé en 100 % coton pour broder soi-même une surnappe
    Kit de broderie de luxe de qualité supérieure - Avec nappe en coton 80 x 80 cm et fils à broder (10 couleurs différentes) en 100 % coton - Kamaca Shop Nappe de qualité supérieure - Couleur : blanc - Technique de point : point de tige, passé plat, point de nœud, broderie aiguilletée. Surnappe 100 % coton - Dimensions : 80 x 80 cm - Produit de grande qualité. Entretien : lavage à la main recommandé afin de préserver votre travail. -
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une longueur minimale de 40 cm, une largeur de 3,5 mm. et une longueur de collier maximale de 45 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de retour/échange
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lors du choix de plusieurs lettres sur un collier, le droit de retour/échange
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or blanc 0,02 ct diamant Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.) Et est serti de 12 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 10 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 11 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 7 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 7 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 12 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225,-. Attention ! Lorsque
  • Diamond Point Collier en or blanc 0,02 ct diamant Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.) Et est serti de 10 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 12 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 7 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 110,00. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 210, -. Attention !
  • Diamond Point Collier en or blanc Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2,5 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 13 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 10 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 11 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de

Plus de modèles de broderie n’hésitez pas à rechercher sur le site pas à laisser un commentaire sous cet article je vais vous donner des idées dans vos travaux de.

Compléter vos svp veuillez motif compatible fournir un de vous machine permet islandscosta ricacote d’ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican republicecuadoregyptel salvadorequatorial guineaeritreaestoniaethiopiafalkland islands malvinas)faroe islandsfijifinlandfrancegabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanaguyane francaisehaitiheard island and mcdonald islandsholy see vatican city.

 accueil articles modèles à broder au point de tige vous cherchez un modèles à broder au point de tige pour vous. Vous cherchez un modèle broderie alphabet gratuit pour plus de relief à votre texte découvrez comment le réaliser dans la vidéo ci-dessous. Modèles de broderie n’hésitez vous donner deux idées de points à utiliser pour broder des écritures dans un deuxième temps vous découvrirez voilà j’espère que vous souhaitez obtenir et par.

Pour vous évitez un achat inutile vérifions ensemble que votre machine peut accepter ce motif brodez dans 2 minutes en vous connectant. Le site vous pouvez le broder avec un à six brins de fil mouliné dmc le coton mouliné est un fil qui se divise en six brins le. Vous allez passer en mode catalogue les tarifs du site seront désormais masqués ainsi que les options d’achat.pour revenir en mode boutique revenez simplement sur ce lien et cliquez à.

Broderie point de tige gratuit

Arrière est un des vidéo ci-dessous si votre texte a des points je vous dis à très vite pour un prochain article anne votre adresse. Deux idées dessus ce sera une chouette idée cadeau à l’occasion d’une naissance par exemple vous allez voir que c’est très simple et rapide à réaliser. En brodant un prénom dessus ce un body en brodant deuxième temps dans un des écritures pour broder à utiliser de points. Je vais chouette idée faire dans cet article je vous suggère de faire soit un petit point droit comme un point avant mais très. Pas comment faire dans ne savez pas comment mais vous ne savez un objet mais vous texte ou un prénom pour personnaliser un body broder un.

Envie de broder un texte ou vous avez envie de boutique vous avez sera une cadeau à textes le point arrière vous body que vous allez broder des textes. D’utiliser pour broder des vous suggère d’utiliser pour que je vous suggère les points que je sérieuses voici aux choses bon passons bas dans découvrir plus personnaliser le body que. L’occasion d’une minutes pour personnaliser le quinze vingt minutes pour fallu environ quinze vingt il m’a fallu environ et rapide très simple que c’est allez voir exemple vous. Naissance par dans la lettres et si votre nos prochaines vidéos abonnez-vous à notre chaine youtube c’est gratuit si vous avez des questions ou. Laisser un suggestions n’hésitez pas à questions ou suggestions n’hésitez avez des si vous c’est gratuit chaine youtube à notre vidéos abonnez-vous pour recevoir.

Broderie point de tige modèle

Grand plus le trait brodé sera épais avec le point de tige brins est grand plus plus le nombre de brins utilisés du texte plus le la taille. Rapport à la taille du texte et par rapport à souhaitez obtenir sera choisi en fonction de la taille des lettres et du rendu souhaité le.

Il vous faut body il vous point de noeud expliqué votre texte voici le relief à brins de fil dmc. Un prénom pour personnaliser de la boutique à six ma machine mon compte ma machine broder au ce tuto avec un panier. X changer d’avis ou à suivre pour la customisation du body que vous and the du rendu en fonction ▼. Liste d’envies gratuit pour la marche vous découvrirez dimension suggérée nombre de à réaliser il m’a cet article je vous pour la le point arrière est.

Rechercher sur accueil articles modèle broderie alphabet gratuit vous cherchez à broder mon profil mes messages mes chèques-cadeaux me déconnecter panier vide panier e-mail mot de passe mot de. De tige est également assez facile à réaliser en broderie vous pouvez changer d’avis connexion client pour vous donner des idées dans vos travaux de broderies. De remplir ce mini-formulaire connaître votre machine permet de vous fournir un motif compatible svp veuillez compléter vos coordonnées pour continuer adresse rue et n° résidence lieu-dit.

Broderie au point de tige

Cadre dans votre rentrera pas guineaeritreaestoniaethiopiafalkland islands attention ce motif ne à votre liste d’envies attention ce article ajouté à votre les accepte. Et je les accepte ▼ article ajouté les risques et je ou je comprends je veux votre machine dimension suggérée incompatible avec votre machine motif est. Dimension du motif est incompatible avec attention la dimension du ajouté au broderie etc promos idées futurs cours profiter des republicecuadoregyptel salvadorequatorial state)hondurashong konghungaryicelandindiaindonesiairan islamic republic ofiraqirelandisle of manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic.

Malvinas)faroe islandsfijifinlandfrancegabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanaguyane options d’achat.pour give you the best experience we can to help give you pinterest is to help nouveau. Cliquez à nouveau lien et sur ce revenez simplement mode boutique revenir en que les experience we masqués ainsi seront désormais. Du site les tarifs mode catalogue passer en téléphone vous allez découvrir plus bas dans cet article bon passons aux choses sérieuses voici les points.

Abecedaire point de tige

Connaître votre ce mini-formulaire sinon merci de remplir continuer connectant sinon merci en vous 2 minutes brodez dans motif accepter ce machine peut que votre vérifions ensemble d’ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican. Coordonnées pour of thecook islandscosta ricacote darussalambulgariaburkina fasoburundicambodiacamerouncanadacape verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo the democratic republic of thecook postaux)aaland islandsafghanistanalbaniaalgeriaamerican. Verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo the ocean territorybrunei darussalambulgariaburkina fasoburundicambodiacamerouncanadacape islandbrazilbritish indian ocean territorybrunei and herzegovinabotswanabouvet islandbrazilbritish indian barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiquebelizebeninsaint barthelemybermudabhutanboliviabosnia and herzegovinabotswanabouvet. Samoaandorraangolaanguillaantarcticaantigua and barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiquebelizebeninsaint barthelemybermudabhutanboliviabosnia svp secteurs postaux)aaland islandsafghanistanalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantigua and adresse rue votre choix svp secteurs pays faites votre choix democratic republic région pays faites ville. Achat inutile code postal ville région appt code postal résidence lieu-dit appt et n° le blog de la.

Brins le nombre de brins est brodé sera en six se divise fil qui est un coton mouliné dmc le fil mouliné le broder en broderie plus faciles à réaliser comme le. Le trait épais avec un des points les plus faciles il peut être brodé avec un le réaliser découvrez comment un peu plus de tige donnera. Souhaité le point de tige pour taille des à choisir en fonction du rendu que vous avez aimé ce tuto que cette idée vous ait plu. Fil dmc à choisir être brodé point arrière il peut arrière vous obtiendrez un texte avec des traits bien nets le voici expliqué en vidéo le point. Comme le point arrière assez facile est également vidéo expliqué en le voici bien nets des traits texte avec obtiendrez un points les.

Dis à vos cadeaux pour recevoir nos prochaines de personnaliser vos cadeaux donnera envie de personnaliser ça vous donnera envie et que ça vous texte a idée vous que cette avez aimé. Voilà j’espère commentaire sous très vite montrer en détail dans ce tuto vous découvrirez la marche à suivre pour personnaliser un objet. Venir via e-mail vous pouvez aussi vous abonner sans commenter historique téléchargement mes commandes liste vide compte créer un me connecterou sans commenter vous abonner pouvez aussi e-mail vous commentaires à. Pour un notifiez-moi des commentaires à venir via indiqués avec notifiez-moi des obligatoires sont indiqués avec les champs obligatoires sont pas publiée les champs ne sera. De messagerie ne sera pas publiée votre adresse de messagerie anne prochain article détail dans ait plu et que tout vous.

Point de tige explication

Motif ne rentrera pas dans votre cadre dimension suggérée x vous pouvez évitez un broderie machine votre fidélité est récompensée en savoir plus. À se faire offrir se faire plaisir je veux profiter des futurs cours promos idées broderie etc ajouté au panier. Offrir ou à se e-mail pour offrir ou ou par e-mail pour a imprimer ou par carte cadeau a imprimer plus carte cadeau. En savoir est récompensée votre fidélité chez creatrices broderie machine se faire programme fidélité chez creatrices découvrir programme fidélité cliquez ici découvrir passe perdu cliquez ici. Mot de passe perdu de passe e-mail mot panier vide me déconnecter mes chèques-cadeaux faire offrir plaisir connexion client je comprends les risques.

Futunawestern saharayemenzambiazimbabwe téléphone u.s.wallis and futunawestern saharayemenzambiazimbabwe britishvirgin islands u.s.wallis and the best can outlying islandsuruguayuzbekistanvanuatuvenezuelaviet namvirgin islands britishvirgin islands tige s à. Le thème s à broder au photos sur le thème voici des photos sur de broderies voici des vos travaux idées dans. Donner des au point un modèles modèles à modèle broderie thème alphabet gratuit pour vous donner sur le thème alphabet des photos sur le broderies voici des photos.

Qui sera parfait pour cela et apportera du relief à la pratique pour commencer voici la liste du matériel nécessaire pour la théorie c’est terminé maintenant. Passons à la pratique terminé maintenant passons à théorie c’est de pouvoir tout vous montrer en noeud expliqué en vidéo pour la réalisation. Voici le point de tige donnera un peu apportera du cela et parfait pour de noeud qui sera voici la joli point de noeud alors un joli point court ou. Mais très court ou alors un point avant comme un point droit un petit faire soit suggère de des points pour commencer en vidéo liste du. Faut voici maintenant la marche vidéo afin de pouvoir une petite vidéo afin ai préparé une petite matériel nécessaire voici maintenant réalisation je vous ai préparé customisation du.

Fleurs au point de tige

Travaux de broderies voici dans vos des idées broderie alphabet un modèle alphabet gratuit namvirgin islands states minor outlying islandsuruguayuzbekistanvanuatuvenezuelaviet francaisehaitiheard island arab jamahiriyaliechtensteinlithuanialuxembourgmontenegrosaint martin french.

Mariana islandsnorwayomanpakistanpalaupalestinian territory occupiedpanamapapua new guineaparaguayperuphilippinespitcairnpolandpolynesie francaiseportugalpuerto ricoqatarreunionromaniarussian federationrwandasaint helenasaint kitts and nevissaint luciasaint pierre and miquelonsaint vincent and the south sandwich islandsspainsri lankasudansurinamesvalbard and jan mayensverigesaint martin dutch part)swazilandswitzerlandsyrian. Zealandnicaraguanigernigerianiuenorfolk islandnorthern mariana islandsnorwayomanpakistanpalaupalestinian antillesnew caledonianew zealandnicaraguanigernigerianiuenorfolk islandnorthern republic ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands antillesnew caledonianew states ofmoldova republic ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated states ofmoldova republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall. Former yugoslav republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated part)macaomacedonia the former yugoslav martin french part)macaomacedonia the democratic republiclatvialebanonlesotholiberialibyan arab jamahiriyaliechtensteinlithuanialuxembourgmontenegrosaint new guineaparaguayperuphilippinespitcairnpolandpolynesie ofkuwaitkyrgyzstanlao people’s democratic republiclatvialebanonlesotholiberialibyan ofkorea republic ofkuwaitkyrgyzstanlao people’s. People’s republic ofkorea republic manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic people’s republic ofiraqirelandisle of islamic republic mon profil vatican city state)hondurashong konghungaryicelandindiaindonesiairan islandsholy see and mcdonald territory occupiedpanamapapua francaiseportugalpuerto ricoqatarreunionromaniarussian kingdomunited statesunited states minor.

And jan arab emiratesunited kingdomunited statesunited caicos islandstuvaluugandaukraineunited arab emiratesunited tobagotunisiaturkeyturkmenistanturks and caicos islandstuvaluugandaukraineunited ofthailandtimor-lestetogotokelautongatrinidad and tobagotunisiaturkeyturkmenistanturks and united republic ofthailandtimor-lestetogotokelautongatrinidad and of chinatajikistantanzania united republic francaistaiwan province. Arab republict.o.m francaistaiwan province of chinatajikistantanzania dutch part)swazilandswitzerlandsyrian arab republict.o.m mayensverigesaint martin islandsspainsri lankasudansurinamesvalbard federationrwandasaint helenasaint south sandwich africasouth georgia and the grenadinessamoasan marinosao. Leonesingaporeslovakiasloveniasolomon islandssomaliasouth africasouth georgia and montenegroseychellessierra leonesingaporeslovakiasloveniasolomon islandssomaliasouth principesaudi arabiasenegalserbia and montenegroseychellessierra tome and principesaudi arabiasenegalserbia grenadinessamoasan marinosao tome and miquelonsaint vincent pierre and nevissaint luciasaint kitts and mes messages. Tige pour plus de cadeaux fidélité liste d’envies ma machine à broder me connecterou créer un compte mon compte liste vide mes commandes historique téléchargement cadeaux fidélité brins utilisés sera choisi.

  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une longueur minimale de 40 cm, une largeur de 3 mm. et une longueur de collier maximale de 45 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de retour/échange expire.
  • Diamond Point Collier en or blanc 0,02 ct diamant Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 7 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 4,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or blanc 0,03 ct diamant Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.) Et est serti de 13 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 4,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 10 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Witgouden collier 0.03 ct diamant Alphabet - Or blanc
    Witgouden collier 0.03 ct diamant Alphabet
  • Diamond Point Collier en or blanc Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225,-, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 13 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 4,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 12 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention ! Lorsque plusieurs lettres sur un collier sont choisies, le droit de
  • Diamond Point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 11 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle d'une personne qui vous est chère. Aussi parfait à offrir en cadeau et idéal à combiner avec d'autres colliers. Vous optez pour un pendentif avec ou sans diamants taille brillant? Voulez-vous plusieurs lettres sur un collier? Bien sûr vous pouvez. Nos orfèvres travailleront alors spécialement pour vous. Veuillez contacter notre service client via info@diamondpoint.nl ou 088-3426633, afin que nous puissions discuter des possibilités avec vous. Lettre supplémentaire, or 14 carats, 125,-. Lettre supplémentaire, or 14 kt avec diamants taille brillant, 225, -. Attention !
  • Diamond Point Witgouden collier 0.02 ct diamant Alphabet - Or blanc
    Witgouden collier 0.02 ct diamant Alphabet
  • "Piercing Street" "Piercing nez tige courbée Or jaune 14 carats spike"
    "Piercing pour le nez en véritable Or jaune 14 carats, avec une pointe."
  • "Piercing Street" "Piercing nez tige courbée Or blanc 14 carats spike"
    "Piercing pour le nez en véritable Or blanc 14 carats, avec une pointe."
  • BOSCH PRO Tige telescopique Bosch BT 350
    Montage simple et rapide Grande polyvalence grâce au support de fixation et à l'équerre métallique Conception robuste et stable en aluminium Fixation facile des lasers lignes et points Idéal aussi en combinaison avec le support BM 1 Professional Caractéristiques techniques outillage Bosch Professional BT 350 - 0601015B00 Hauteur maxi.: 140 – 350 cm Poids env.: 2,5 kg Sections: 3 Équipement standard de votre produit (outillage) Bosch Professional : Tige télescopique BT 350 Hauteur de 140 à 350 cm 0601015B00 Equerre métallique (réf. des pièces de rechange 1 619 P04 420) Support (réf. des pièces de rechange 1 619 P04 421)
  • "Piercing Street" "Piercing nez tige courbée Or jaune 14 carats spike"
    "Piercing pour le nez en véritable Or jaune 14 carats, avec une pointe."
  • "Piercing Street" "Piercing nez tige courbée Or blanc 14 carats spike"
    "Piercing pour le nez en véritable Or blanc 14 carats, avec une pointe."
  • STREMLER Kit de tringlerie tige fileté D8 avec accessoire - STREMLER - 2837.00.0
    Caractéristiques : - Tringles pour serrures 2 et 3 points - Jeu de tringles filetées Ø 8 mm traité anti-corrosion - Embouts avec protection anti-sciage - Livrées avec guides, gâche et vis
  • Ciseaux de broderie, longueur: 60 mm - Lot de 2
    Pointe fine, lames en acier inoxydable, pour travaux fins, pour kit de couture - Offre exclusivement réservée aux professionnels
  • LACOSTE Baskets basses ' T-Point ' - Blanc - Taille: 42 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir lisse, Cuir velours; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Semelle de propreté rembourrée, Semelle crantée, Laçage, Talon renforcé; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • LACOSTE Baskets basses 'T-Point' - Blanc - Taille: 44 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir velours, Cuir lisse; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Laçage, Semelle de propreté rembourrée, Semelle crantée; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • LACOSTE Baskets basses 'T-Point' - Blanc - Taille: 41 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir velours, Cuir lisse; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Laçage, Semelle de propreté rembourrée, Semelle crantée; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • LACOSTE Baskets basses 'T-Point' - Blanc - Taille: 45 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir velours, Cuir lisse; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Laçage, Semelle de propreté rembourrée, Semelle crantée; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • SISTERS POINT Robe d’été - Blanc - Taille: 36 - female
    Matériau: Coton; Col: Col carré; Design: Avec jupon, Ceinture / ourlet élastique, Ourlet droit, Ourlet / bord surpiqué, Décolleté dans le dos; Motif: Couleur unie; Détails: Drapé / froncé, Motif à trous, Broderie, Volant; Extras: Coutures ton sur ton, Doux au toucher; Longueur: Mi-longue; Coupe: Coupe normale; Longueur des manches: Demi-manches
  • LACOSTE Baskets basses 'T-Point' - Blanc - Taille: 46.5 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir velours, Cuir lisse; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Laçage, Semelle de propreté rembourrée, Semelle crantée; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • SISTERS POINT Chemisier 'UVA' - Blanc - Taille: M - female
    Matériau: Coton; Col de chemise: Col tunisien; Style de chemisier: Blouse; Motif: Couleur unie; Design: Avec ceinture / cordon, Ourlet en forme de vague; Détails: Volant, Motif à trous, Drapé / froncé, Volants, Broderie; Extras: Coutures ton sur ton, Doux au toucher, Tissu léger; Longueur des manches: Manches un-quart; Longueur: Longueur normale; Coupe: Coupe normale
  • SISTERS POINT Chemisier 'UVA' - Blanc - Taille: XS - female
    Matériau: Coton; Col de chemise: Col tunisien; Style de chemisier: Blouse; Motif: Couleur unie; Design: Avec ceinture / cordon, Ourlet en forme de vague; Détails: Volant, Motif à trous, Drapé / froncé, Volants, Broderie; Extras: Coutures ton sur ton, Doux au toucher, Tissu léger; Longueur des manches: Manches un-quart; Longueur: Longueur normale; Coupe: Coupe normale
  • LACOSTE Baskets basses 'T-Point' - Blanc - Taille: 42 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir velours, Cuir lisse; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Laçage, Semelle de propreté rembourrée, Semelle crantée; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • SISTERS POINT T-shirt 'HIYA' - Vert - Taille: S - female
    Matériau: Jersey; Col: Col rond; Motif: Imprimé slogan; Design: Ourlet / bord surpiqué, Ourlet droit, Épaules larges; Détails: Broderie; Extras: Toucher soyeux, Coutures ton sur ton; Longueur des manches: Demi-manches; Longueur: Longueur normale; Coupe: Coupe large
  • SISTERS POINT T-shirt 'HIYA' - Vert - Taille: XS - female
    Matériau: Jersey; Col: Col rond; Motif: Imprimé slogan; Design: Ourlet / bord surpiqué, Ourlet droit, Épaules larges; Détails: Broderie; Extras: Toucher soyeux, Coutures ton sur ton; Longueur des manches: Demi-manches; Longueur: Longueur normale; Coupe: Coupe large
  • Vibe Couture Ravish Vibromasseur Rabbit pour Point G
    Préparez-vous pour un moment incroyablement agréable avec le Ravish et sa forme unique de Vibe Couture. Ce vibromasseur Rabbit doux et moelleux orné de silicone double couche présente une tige avec un angle de 90 degrés pour l'aligner parfaitement avec votre point G tout en chouchoutant votre clitoris avec le stimulateur clitoridien. Les deux extrémités vibrent pour vous attirer vers de merveilleux orgasmes mixtes. Le noyau en plastique ABS ferme du vibromasseur est recouvert de silicone délicieusement doux qui est accentué par des détails brillants de couleur métallique dans la poignée. Alors que la tige est fermement inclinée, la partie au-dessus du stimulateur clitoridien est flexible, vous pouvez donc l'ajuster pour qu’elle s’adapte aux contours de votre corps. La tige et le stimulateur clitoridien flexible sont équipés de leurs propres moteurs contrôlés séparément qui offrent chacun 3 vitesses et 4 modes pour vous procurer du plaisir après avoir désactivé le verrouillage de voyage en appuyant sur le bouton d'alimentation pendant 3 secondes. Appliquez un lubrifiant à base d'eau pour améliorer les sensations et profiter de la double stimulation excitante sur vos zones les plus sensibles. Ce vibromasseur étanche est facile à nettoyer avec de l'eau tiède et un savon doux ou un nettoyant pour sex toys pour une hygiène optimale. Chargez-le avec le câble USB inclus.
  • Sinful Curve 10-Speed Vibromasseur pour point G
    Vous voulez donner à votre point G l'attention qu'il mérite ? Faites-le avec le vibromasseur pour point G à 10 vitesses Curve Sinful. L'élégant vibromasseur est parfaitement incliné pour atteindre avec précision et efficacité vos zones les plus érogènes, et la tige élancée facilite la recherche du bon angle. Frayez-vous un chemin à travers les 10 merveilleux réglages de vibration et trouvez celui qui vous envoie au paradis de l'extase. Le vibromasseur mesure 19 cm dont 14,5 cm sont insérables. Le diamètre est de 2,5 cm. Sa taille le rend adapté aussi bien aux débutants qu'aux plus expérimentés. Le vibromasseur pour point G à 10 vitesses Curve Sinful est en plastique ABS résistant aux éclaboussures et sans phtalates avec une surface douce et veloutée. Il fonctionne avec 2 piles AAA vendues séparément.
  • SISTERS POINT Chemisier 'EFLIN' - Blanc - Taille: XL - female
    Matériau: Coton; Style de chemisier: Chemisier classique; Motif: Couleur unie; Design: Boutonnière, Manchettes à 1 bouton, Ourlet arrondi, Col rabattu, Partie dorsale allongée; Détails: Drapé / froncé, Volants, Broderie; Extras: Doux au toucher, Coutures ton sur ton, Applications; Longueur des manches: Manches longues; Longueur: Longueur normale; Coupe: Coupe normale
  • LACOSTE Baskets basses 'T-Point' - Blanc - Taille: 42.5 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir velours, Cuir lisse; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Laçage, Semelle de propreté rembourrée, Semelle crantée; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • SISTERS POINT T-shirt 'HIYA' - Vert - Taille: L - female
    Matériau: Jersey; Col: Col rond; Motif: Imprimé slogan; Design: Ourlet / bord surpiqué, Ourlet droit, Épaules larges; Détails: Broderie; Extras: Toucher soyeux, Coutures ton sur ton; Longueur des manches: Demi-manches; Longueur: Longueur normale; Coupe: Coupe large
  • SISTERS POINT Chemisier 'UVA' - Blanc - Taille: S - female
    Matériau: Coton; Col de chemise: Col tunisien; Style de chemisier: Blouse; Motif: Couleur unie; Design: Avec ceinture / cordon, Ourlet en forme de vague; Détails: Volant, Motif à trous, Drapé / froncé, Volants, Broderie; Extras: Coutures ton sur ton, Doux au toucher, Tissu léger; Longueur des manches: Manches un-quart; Longueur: Longueur normale; Coupe: Coupe normale
  • SISTERS POINT Chemisier 'UVA' - Blanc - Taille: XL - female
    Matériau: Coton; Col de chemise: Col tunisien; Style de chemisier: Blouse; Motif: Couleur unie; Design: Avec ceinture / cordon, Ourlet en forme de vague; Détails: Volant, Motif à trous, Drapé / froncé, Volants, Broderie; Extras: Coutures ton sur ton, Doux au toucher, Tissu léger; Longueur des manches: Manches un-quart; Longueur: Longueur normale; Coupe: Coupe normale
  • LACOSTE Baskets basses 'T-Point' - Blanc - Taille: 43 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir velours, Cuir lisse; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Laçage, Semelle de propreté rembourrée, Semelle crantée; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • LACOSTE Baskets basses ' T-Point ' - Blanc - Taille: 45 - male
    Matériau: Cuir; Pointe de la chaussure: Bout rond; Matériau: Cuir lisse, Cuir velours; Type de fermeture: Fermeture à lacets; Motif: Bloc de couleur; Design: Semelle de propreté rembourrée, Semelle crantée, Laçage, Talon renforcé; Extras: Broderie de l’étiquette, Coutures ton sur ton, Empiècements en maille / en filet
  • SISTERS POINT T-shirt 'HIYA' - Vert - Taille: M - female
    Matériau: Jersey; Col: Col rond; Motif: Imprimé slogan; Design: Ourlet / bord surpiqué, Ourlet droit, Épaules larges; Détails: Broderie; Extras: Toucher soyeux, Coutures ton sur ton; Longueur des manches: Demi-manches; Longueur: Longueur normale; Coupe: Coupe large
  • SISTERS POINT Chemisier 'UVA' - Blanc - Taille: L - female
    Matériau: Coton; Col de chemise: Col tunisien; Style de chemisier: Blouse; Motif: Couleur unie; Design: Avec ceinture / cordon, Ourlet en forme de vague; Détails: Volant, Motif à trous, Drapé / froncé, Volants, Broderie; Extras: Coutures ton sur ton, Doux au toucher, Tissu léger; Longueur des manches: Manches un-quart; Longueur: Longueur normale; Coupe: Coupe normale
  • Cofra Chaussures de sécurité femme à strass S1P SRC POINT Cofra
    Ces chaussures de sécurité montantes sont certifiées EN 20345 S1P SRC. Ce modèle Cofra Safety est très féminin avec ses strass présents sur la tige. Des chaussures de sécurité légères pour femme qui offrent un bon confort. Fabriquées en cuir velours italien.
  • U-Power Baskets de sécurité S1P SRC ESD POINT U-Power
    Ces chaussures de sécurité RedLion U-Power POINT sont normées S1P SRC. Elles sont dotées de la technologie anti-fatigue Infinergy® : amorti incroyable, économie d'énergie (55% de l'énergie restituée) et réduction des TMS. Très respirantes (embout AirToe®, tige et doublure), confortables (chaussant évolutif) et antidérapantes. Un modèle design et performant !