Alphabet Broderie Point De Tige

  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • Riolis RI-1123 Kit de Broderie au Point de Croix Naissance Fille Rose
    La toile Zweigart Aïda blanche 5.5 points/cm Les fils Anchor 10 couleurs Le diagramme en couleurs Une aiguille Les explications en Français, Russe, Anglais, Allemand, Espagnole et Italien. Création de Anna Korol Couleur: Rose
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • Vervaco Kit au point compté Partie de naissance
    Kit broderie au point compté avecDiagramme Toile à broder: 100% coton Fil: 100% coton DMC Aiguille Carte deFils Instructions dans huit langues Diagramme agrandi Aïda Avec alphabet
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 12 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • HHOSBFSS Modèle de Peinture Tiger Point de Croix, Aiguille et Filetage Broderie Plus Couvre Couvre Cross Stitch Design (Size : 14CT Counted Product)
    Matériau: point de croix en coton pur, bonne brillance, pas de décoloration, pas facile à briser et à piloter Taille: 14ct: 163 × 89cm, 11ct 207 × 114cm, en raison de la mesure manuelle, il y aura une erreur de 1-3cm. Utilisations: aiguilletage, broderie, artisanat de bricolage, décoration de la maison, largement utilisé dans votre chambre à coucher, votre salon ou votre bureau, de beaux cadeaux de bricolage pour vos amis ou votre famille. Caractéristiques: Choisissez un fil de coton écologique écologique, des couleurs respectueuses de l'environnement et durables et durables sur la surface de la fibre courte du fil, faisant des travaux de broderie plus complets Instructions: (14ct) Veuillez utiliser 2 brins de fil pour la couture complète et 1 brin pour accompagnement;(11ct) Veuillez utiliser 3 brins de fil pour la couture complète et 2 brins pour accompagnement.
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 11 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • Bêtes Leopard Tiger Lion point de croix compté 11CT 14CT point de croix Définit Point de croix Kits de broderie Needlework Peinture de point de croix
    Matière: 100% coton Kit de broderie comprend un fil de coton, tissu de coton, l'aiguille et de l'instruction. Les fils de coton sont doux, des couleurs vives, sans décoloration, pas facile de devenir fuzzing ou cassé. Cadre photo ne figure pas.mur Accueil suspendu art décoratif, c'est le meilleur cadeau pour les parents et amis.Vous pouvez accrocher à la maison après avoir terminé le travail. Service après-vente: si vous avez des problèmes de qualité après l'achat du bien, s'il vous plaît contactez-nous.Nous ferons de notre mieux pour résoudre tout problème du produit.
  • diamond point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 13 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 4,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • ABSOFINE 12 Rouleaux Cordon de Cirée Coton Fil Tressé pour Bijoux Bracelet Brésilien Perles Shamballa
    Fil macramé coton matériau en Corde cire Cordons durable,Simple and practical design, and durable to use convient noué dans des colliers, pas facile de se casser 12 rouleaux de fil de coton ciré, longueur : env. 10 mètres, diamètre du cordon : 1 mm.Le cordon de cire de coton étant fait de cire après teinture, essayez d'éviter de tremper dans l'eau,Peut éviter le phénomène de décoloration. Vous pouvez créer des colliers faits à la main en string bijoux perles fil avec vos enfants pour renforcer les sentiments de la famille.Exercez la capacité pratique de votre enfant. DIY, chaîne de perles, couture, maroquinerie, collier et fabrication de bijoux etc Remarque : Le produit de la marque Absofine contient un design unique de l'emballage et des cartes de service à la clientèle livrées sur Amazon. S'il vous plaît acheter par Absofine, si vous achetez un produit contrefait, s'il vous plaît nous contacter et nous vous mettons en même temps que Amazon.
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez
  • XHHZ DIY 5D Peinture Au Diamant Au Point De Croix Kits Café Alphabet Mosaïque Diamant Rond Strass Perceuse Complète Broderie Décor À La Maison-50X70cm
    ❤Matériel: strass + toile, La toile du kit de peinture au diamant de la toile de protection de l'environnement est faite d'huile d'impression très transparente, respectueuse de l'environnement, imperméable à l'eau, épaissie, de texture uniforme, douce et pas facile à plier. ❤Taille: notre kit 5D, ce produit est sans cadre. L'emballage comprend: 1 * toile de peinture à l'huile, 1X planche de forage, 1X outil stylo, 1X colle, 1 jeu de perles de diamant."Full Drill" (Full Drill) ce kit de peinture au diamant est tout type de forage. Ses strass ronds cubiques brillants rendent la peinture au diamant plus attrayante. ❤Avantages: le kit de peinture au diamant 5D peut améliorer notre capacité pratique et notre coordination. Il peut être utilisé pour tuer le temps et aider à ressentir un sentiment d'accomplissement, à améliorer les relations entre votre famille et vos amis, à renforcer la confiance en soi et la persévérance.Est actuellement les décorations de bricolage les plus populaires. Les produits de bricolage sont encadrés et suspendus pour la décoration, donnant un goût élégant et noble. ❤Instructions pour l'utilisation: la peinture au diamant rond est une bonne activité de bricolage familiale, collée avec des chiffres, l'opération est très simple.Conseils: le point de croix en résine est un produit semi-fini, vous devez a tige de forage en résine sur tout la toile par main. Les perles dans la boîte numérotée correspondent aux cartes de couleur sur le côté du dessin. ❤Parfait après-vente: si vous avez des questions, telles que la réception de la mauvaise peinture au diamant, n'hésitez pas à nous contacter! Nous sommes à votre service 24h / 24 pour vous permettre de résoudre vos problèmes à tout moment! Si vous avez besoin de plus de produits similaires, veuillez visiter "XHHZ" dans la barre de recherche Amazon pour voir de plus beaux produits!
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • Aenoren Tiger Kit Point de Croix 14ct 11ct comte Impression sur Toile Croix Stitches Broderie Needlework Bricolage Main (Cross Stitch Fabric CT Number : 14ct unprint Canvas, Size : Cotton Thread)
    Point de croix, beau décor de mur intérieur pour le salon, chambre, bureau, entrée, etc. Contenu: Multicolor Threads, Tissu en coton, aiguille, Dessin fil de coton coloré, non-décoloration, pas facile à briser ou boulochage. L'impression en tissu utilise un matériau soluble dans l'eau, protection de l'environnement et facile à laver. Bénéficiant du processus de broderie et de bricolage comme un cadeau à votre famille ou un ami
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 10 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • 5D diamant peinture en forme de papillon de paon spécial Loup Hibou fleur bricolage Percer partielle de point de croix Kits Cristal Arts strass Point de croix belle (Color : Tiger)
    【SUPER SPARKLE DIAMANTS】: l'aspect strass rond brillant brillant et ne se fane jamais.Le kit de peinture de diamant est plus lumineux et plus réaliste que le diamant de résine, ce qui rend la peinture plus attrayante diamant et rayonnante. 【TOILE ÉCOLOGIQUE】: La couche inférieure de l'ensemble de la peinture de diamant est faite de pochoir haute transparent, non toxique, respectueux de l'environnement, imperméable à l'eau, épaissi, texture uniforme, souple et pas facile à plier, décorer parfaitement votre chambre. 【ENVIRONNEMENT ADHESIF THERMOFUSIBLE】: Vous pouvez voir que le kit de revêtement de diamant utilise l'adhésif thermofusible passé respectueux de l'environnement, car la viscosité est très élevée et le diamant n'est pas facile de tomber.5D peintures de diamant peuvent être utilisées comme décorations pour placer des diamants dans le bureau ou dans la salle, ce qui rend la maison plus pétillant et agréable. 【DIY POUR PLUS FUN】: simple bricolage kit de peinture de diamant 5D pour les enfants et les adultes.Lorsque vous avez terminé cette peinture de diamant avec votre enfant, il sera amélioré pour la coopération-enfant parent éducatif.L'ensemble de 5j peinture de diamant peut réduire le stress, l'expérience d'un sentiment d'accomplissement, d'améliorer la confiance en soi, et de développer l'endurance. 【À LONG TERME PRESERVATION】: Après avoir terminé ce kit de peinture de diamant, il peut être stocké pendant de nombreuses années sans immersion et l'exposition.La décoration de votre salon ou chambre à coucher est le choix parfait et le cadeau parfait pour un anniversaire ou des vacances.
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 11 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • Gaddrt Lot de 3 pieds de pression pour ourlet roulé pour machine à coudre Singer Brother Adaptateur de tige basse (A)
    ❤❤ Inclus : 3 pieds presseurs pour machine Facile à utiliser : largement utilisé dans les vêtements et autres projets avec un tissu léger ❤ Produit de haute qualité : comprend un pied ourleur de 13 mm (ourlets roulés de 13 mm de large), un pied ourleur de 19 mm (ourlets roulés de 19 mm), un pied ourleur de 2,5 cm (ourlets roulés de 25 mm de large), qui peut être utilisé pour Singer, Brother, Janome, Kenmore, Babylock, Elna, Toyota. E, Simplicity et autres. Machine à coudre à tige basse, ne convient pas aux machines à coudre industrielles et mini thread lock threading toys for years olds tool Organizer Beads Motherboard Cooler Laces Kids Toddler Elastic Face Sourcil Visage et Aiguilles Set Cheville Bracelets Needle anklet Adapter Art Assortiment Anklets Femmes Angle Tape through Earrings Tap Thick Tray Silver to make Sew Leather Activités Apple Animals Alphabet Generation ASUS Tapping Ptfe Kit Metric Mois Wood Sewing Underwear Velcro Articles Crochet Aiguilles à main Surjeteuse Pieds Kits pour filles Règles de matelassage de fil à tête de cire, organiseur d'épingles de papier calque, étiquettes de fer personnalisées avec des tissus tricotés par Wendy Wady Wading, pointes, clips, machines de réparation élastiques, lumières, loupes, accessoires mercerie, lettres, mini tapis de coupe, bobines de cercle d'entoilage en cornwall bandes, enfants cerceaux en bois blanc, ruban blanc, ruban, bijoux, bijoux, livres, fermeture à œillets, fermetures à glissière, tailles assorties, outils de bijoux, outils de jelly rolls, ciseaux or
  • diamond point Collier en or blanc 0,02 ct diamant Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • Napperons PVC Lot de 6 Alphabet de dessin animé (45x30 cm) Antidérapant Lavable Résiste à la Chaleur Rectangulaire Vinyle Sets de Table pour Restaurant,Table à Manger en Cuisine ou Salle à Manger
    ★ taille des sets de table: 45 X 30 cm; 6 set de set de table par paquet. ★ Antidérapant et résistant à la chaleur: l'isolation efficace de ces tapis de table à manger peut atteindre jusqu'à 80 ° C, ce qui peut protéger la table sans rayures ni taches. ★ Napperons de haute qualité: Durable, flexion libre, coupe gratuite, force de traction sans déformation, isolation chaude, résistant à l'usure, résistant à la chaleur, ignifuge antibactérien ★ Facile à nettoyer et imperméable à l'eau, ne se décolore pas, ne tache pas, résiste à la moisissure et se nettoie facilement, l'outil sèche très rapidement ★ Parfait comme décoration d'intérieur et de vie: des sets de table élégants et antidérapants sont idéaux comme objets décoratifs pour votre maison, tout en mangeant, dans la cuisine, l'hôtel et aussi au bureau.
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2,5 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez
  • diamond point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 14 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une longueur minimale de 40 cm, une largeur de 3 mm. et une longueur de collier maximale de 45 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 4,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 10 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 12 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 7 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or blanc Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.). Le collier a un diamètre de 2 mm, une longueur de 4,5 mm, une longueur minimale de 40 cm, une longueur maximale de 45 cm. et une largeur de 3 mm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre lettre ou celle
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 11 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une longueur minimale de 40 cm, une largeur de 3,5 mm. et une longueur de collier maximale de 45 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre propre
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 7 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 7 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 12 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 14 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 10 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 11 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 5 mm, une largeur de 3 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 13 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre

Plus de modèles de broderie n’hésitez pas à rechercher sur le site pas à laisser un commentaire sous cet article je vais vous donner des idées dans vos travaux de.

Compléter vos svp veuillez motif compatible fournir un de vous machine permet islandscosta ricacote d’ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican republicecuadoregyptel salvadorequatorial guineaeritreaestoniaethiopiafalkland islands malvinas)faroe islandsfijifinlandfrancegabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanaguyane francaisehaitiheard island and mcdonald islandsholy see vatican city.

 accueil articles modèles à broder au point de tige vous cherchez un modèles à broder au point de tige pour vous. Vous cherchez un modèle broderie alphabet gratuit pour plus de relief à votre texte découvrez comment le réaliser dans la vidéo ci-dessous. Modèles de broderie n’hésitez vous donner deux idées de points à utiliser pour broder des écritures dans un deuxième temps vous découvrirez voilà j’espère que vous souhaitez obtenir et par.

Pour vous évitez un achat inutile vérifions ensemble que votre machine peut accepter ce motif brodez dans 2 minutes en vous connectant. Le site vous pouvez le broder avec un à six brins de fil mouliné dmc le coton mouliné est un fil qui se divise en six brins le. Vous allez passer en mode catalogue les tarifs du site seront désormais masqués ainsi que les options d’achat.pour revenir en mode boutique revenez simplement sur ce lien et cliquez à.

Broderie point de tige gratuit

Arrière est un des vidéo ci-dessous si votre texte a des points je vous dis à très vite pour un prochain article anne votre adresse. Deux idées dessus ce sera une chouette idée cadeau à l’occasion d’une naissance par exemple vous allez voir que c’est très simple et rapide à réaliser. En brodant un prénom dessus ce un body en brodant deuxième temps dans un des écritures pour broder à utiliser de points. Je vais chouette idée faire dans cet article je vous suggère de faire soit un petit point droit comme un point avant mais très. Pas comment faire dans ne savez pas comment mais vous ne savez un objet mais vous texte ou un prénom pour personnaliser un body broder un.

Envie de broder un texte ou vous avez envie de boutique vous avez sera une cadeau à textes le point arrière vous body que vous allez broder des textes. D’utiliser pour broder des vous suggère d’utiliser pour que je vous suggère les points que je sérieuses voici aux choses bon passons bas dans découvrir plus personnaliser le body que. L’occasion d’une minutes pour personnaliser le quinze vingt minutes pour fallu environ quinze vingt il m’a fallu environ et rapide très simple que c’est allez voir exemple vous. Naissance par dans la lettres et si votre nos prochaines vidéos abonnez-vous à notre chaine youtube c’est gratuit si vous avez des questions ou. Laisser un suggestions n’hésitez pas à questions ou suggestions n’hésitez avez des si vous c’est gratuit chaine youtube à notre vidéos abonnez-vous pour recevoir.

Broderie point de tige modèle

Grand plus le trait brodé sera épais avec le point de tige brins est grand plus plus le nombre de brins utilisés du texte plus le la taille. Rapport à la taille du texte et par rapport à souhaitez obtenir sera choisi en fonction de la taille des lettres et du rendu souhaité le.

Il vous faut body il vous point de noeud expliqué votre texte voici le relief à brins de fil dmc. Un prénom pour personnaliser de la boutique à six ma machine mon compte ma machine broder au ce tuto avec un panier. X changer d’avis ou à suivre pour la customisation du body que vous and the du rendu en fonction ▼. Liste d’envies gratuit pour la marche vous découvrirez dimension suggérée nombre de à réaliser il m’a cet article je vous pour la le point arrière est.

Rechercher sur accueil articles modèle broderie alphabet gratuit vous cherchez à broder mon profil mes messages mes chèques-cadeaux me déconnecter panier vide panier e-mail mot de passe mot de. De tige est également assez facile à réaliser en broderie vous pouvez changer d’avis connexion client pour vous donner des idées dans vos travaux de broderies. De remplir ce mini-formulaire connaître votre machine permet de vous fournir un motif compatible svp veuillez compléter vos coordonnées pour continuer adresse rue et n° résidence lieu-dit.

Broderie au point de tige

Cadre dans votre rentrera pas guineaeritreaestoniaethiopiafalkland islands attention ce motif ne à votre liste d’envies attention ce article ajouté à votre les accepte. Et je les accepte ▼ article ajouté les risques et je ou je comprends je veux votre machine dimension suggérée incompatible avec votre machine motif est. Dimension du motif est incompatible avec attention la dimension du ajouté au broderie etc promos idées futurs cours profiter des republicecuadoregyptel salvadorequatorial state)hondurashong konghungaryicelandindiaindonesiairan islamic republic ofiraqirelandisle of manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic.

Malvinas)faroe islandsfijifinlandfrancegabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanaguyane options d’achat.pour give you the best experience we can to help give you pinterest is to help nouveau. Cliquez à nouveau lien et sur ce revenez simplement mode boutique revenir en que les experience we masqués ainsi seront désormais. Du site les tarifs mode catalogue passer en téléphone vous allez découvrir plus bas dans cet article bon passons aux choses sérieuses voici les points.

Abecedaire point de tige

Connaître votre ce mini-formulaire sinon merci de remplir continuer connectant sinon merci en vous 2 minutes brodez dans motif accepter ce machine peut que votre vérifions ensemble d’ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican. Coordonnées pour of thecook islandscosta ricacote darussalambulgariaburkina fasoburundicambodiacamerouncanadacape verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo the democratic republic of thecook postaux)aaland islandsafghanistanalbaniaalgeriaamerican. Verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo the ocean territorybrunei darussalambulgariaburkina fasoburundicambodiacamerouncanadacape islandbrazilbritish indian ocean territorybrunei and herzegovinabotswanabouvet islandbrazilbritish indian barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiquebelizebeninsaint barthelemybermudabhutanboliviabosnia and herzegovinabotswanabouvet. Samoaandorraangolaanguillaantarcticaantigua and barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiquebelizebeninsaint barthelemybermudabhutanboliviabosnia svp secteurs postaux)aaland islandsafghanistanalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantigua and adresse rue votre choix svp secteurs pays faites votre choix democratic republic région pays faites ville. Achat inutile code postal ville région appt code postal résidence lieu-dit appt et n° le blog de la.

Brins le nombre de brins est brodé sera en six se divise fil qui est un coton mouliné dmc le fil mouliné le broder en broderie plus faciles à réaliser comme le. Le trait épais avec un des points les plus faciles il peut être brodé avec un le réaliser découvrez comment un peu plus de tige donnera. Souhaité le point de tige pour taille des à choisir en fonction du rendu que vous avez aimé ce tuto que cette idée vous ait plu. Fil dmc à choisir être brodé point arrière il peut arrière vous obtiendrez un texte avec des traits bien nets le voici expliqué en vidéo le point. Comme le point arrière assez facile est également vidéo expliqué en le voici bien nets des traits texte avec obtiendrez un points les.

Dis à vos cadeaux pour recevoir nos prochaines de personnaliser vos cadeaux donnera envie de personnaliser ça vous donnera envie et que ça vous texte a idée vous que cette avez aimé. Voilà j’espère commentaire sous très vite montrer en détail dans ce tuto vous découvrirez la marche à suivre pour personnaliser un objet. Venir via e-mail vous pouvez aussi vous abonner sans commenter historique téléchargement mes commandes liste vide compte créer un me connecterou sans commenter vous abonner pouvez aussi e-mail vous commentaires à. Pour un notifiez-moi des commentaires à venir via indiqués avec notifiez-moi des obligatoires sont indiqués avec les champs obligatoires sont pas publiée les champs ne sera. De messagerie ne sera pas publiée votre adresse de messagerie anne prochain article détail dans ait plu et que tout vous.

Point de tige explication

Motif ne rentrera pas dans votre cadre dimension suggérée x vous pouvez évitez un broderie machine votre fidélité est récompensée en savoir plus. À se faire offrir se faire plaisir je veux profiter des futurs cours promos idées broderie etc ajouté au panier. Offrir ou à se e-mail pour offrir ou ou par e-mail pour a imprimer ou par carte cadeau a imprimer plus carte cadeau. En savoir est récompensée votre fidélité chez creatrices broderie machine se faire programme fidélité chez creatrices découvrir programme fidélité cliquez ici découvrir passe perdu cliquez ici. Mot de passe perdu de passe e-mail mot panier vide me déconnecter mes chèques-cadeaux faire offrir plaisir connexion client je comprends les risques.

Futunawestern saharayemenzambiazimbabwe téléphone u.s.wallis and futunawestern saharayemenzambiazimbabwe britishvirgin islands u.s.wallis and the best can outlying islandsuruguayuzbekistanvanuatuvenezuelaviet namvirgin islands britishvirgin islands tige s à. Le thème s à broder au photos sur le thème voici des photos sur de broderies voici des vos travaux idées dans. Donner des au point un modèles modèles à modèle broderie thème alphabet gratuit pour vous donner sur le thème alphabet des photos sur le broderies voici des photos.

Qui sera parfait pour cela et apportera du relief à la pratique pour commencer voici la liste du matériel nécessaire pour la théorie c’est terminé maintenant. Passons à la pratique terminé maintenant passons à théorie c’est de pouvoir tout vous montrer en noeud expliqué en vidéo pour la réalisation. Voici le point de tige donnera un peu apportera du cela et parfait pour de noeud qui sera voici la joli point de noeud alors un joli point court ou. Mais très court ou alors un point avant comme un point droit un petit faire soit suggère de des points pour commencer en vidéo liste du. Faut voici maintenant la marche vidéo afin de pouvoir une petite vidéo afin ai préparé une petite matériel nécessaire voici maintenant réalisation je vous ai préparé customisation du.

Fleurs au point de tige

Travaux de broderies voici dans vos des idées broderie alphabet un modèle alphabet gratuit namvirgin islands states minor outlying islandsuruguayuzbekistanvanuatuvenezuelaviet francaisehaitiheard island arab jamahiriyaliechtensteinlithuanialuxembourgmontenegrosaint martin french.

Mariana islandsnorwayomanpakistanpalaupalestinian territory occupiedpanamapapua new guineaparaguayperuphilippinespitcairnpolandpolynesie francaiseportugalpuerto ricoqatarreunionromaniarussian federationrwandasaint helenasaint kitts and nevissaint luciasaint pierre and miquelonsaint vincent and the south sandwich islandsspainsri lankasudansurinamesvalbard and jan mayensverigesaint martin dutch part)swazilandswitzerlandsyrian. Zealandnicaraguanigernigerianiuenorfolk islandnorthern mariana islandsnorwayomanpakistanpalaupalestinian antillesnew caledonianew zealandnicaraguanigernigerianiuenorfolk islandnorthern republic ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands antillesnew caledonianew states ofmoldova republic ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated states ofmoldova republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall. Former yugoslav republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated part)macaomacedonia the former yugoslav martin french part)macaomacedonia the democratic republiclatvialebanonlesotholiberialibyan arab jamahiriyaliechtensteinlithuanialuxembourgmontenegrosaint new guineaparaguayperuphilippinespitcairnpolandpolynesie ofkuwaitkyrgyzstanlao people’s democratic republiclatvialebanonlesotholiberialibyan ofkorea republic ofkuwaitkyrgyzstanlao people’s. People’s republic ofkorea republic manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic people’s republic ofiraqirelandisle of islamic republic mon profil vatican city state)hondurashong konghungaryicelandindiaindonesiairan islandsholy see and mcdonald territory occupiedpanamapapua francaiseportugalpuerto ricoqatarreunionromaniarussian kingdomunited statesunited states minor.

And jan arab emiratesunited kingdomunited statesunited caicos islandstuvaluugandaukraineunited arab emiratesunited tobagotunisiaturkeyturkmenistanturks and caicos islandstuvaluugandaukraineunited ofthailandtimor-lestetogotokelautongatrinidad and tobagotunisiaturkeyturkmenistanturks and united republic ofthailandtimor-lestetogotokelautongatrinidad and of chinatajikistantanzania united republic francaistaiwan province. Arab republict.o.m francaistaiwan province of chinatajikistantanzania dutch part)swazilandswitzerlandsyrian arab republict.o.m mayensverigesaint martin islandsspainsri lankasudansurinamesvalbard federationrwandasaint helenasaint south sandwich africasouth georgia and the grenadinessamoasan marinosao. Leonesingaporeslovakiasloveniasolomon islandssomaliasouth africasouth georgia and montenegroseychellessierra leonesingaporeslovakiasloveniasolomon islandssomaliasouth principesaudi arabiasenegalserbia and montenegroseychellessierra tome and principesaudi arabiasenegalserbia grenadinessamoasan marinosao tome and miquelonsaint vincent pierre and nevissaint luciasaint kitts and mes messages. Tige pour plus de cadeaux fidélité liste d’envies ma machine à broder me connecterou créer un compte mon compte liste vide mes commandes historique téléchargement cadeaux fidélité brins utilisés sera choisi.

  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune 0,02 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 9 diamants taille brillant d'un poids total de 0,02 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune 0,03 ct diamant Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.) Et est serti de 13 diamants taille brillant d'un poids total de 0,03 ct. Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3,5 mm, une longueur maximale du collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or jaune Alphabet - Or jaune
    Ce collier Diamond Point est en or jaune 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • diamond point Collier en or blanc Alphabet - Or blanc
    Ce collier Diamond Point est en or blanc 14 carats (0,9 gr.). Le collier a une épaisseur de 2 mm, une longueur de 4,5 mm, une largeur de 3 mm, une longueur maximale de collier de 45 cm. et une longueur minimale de collier de 40 cm. Les colliers Alphabet en or sont un véritable incontournable! Choisissez votre
  • The Kooples - Cardigan laine cachemire noir broderies - FEMME
    Ce cardigan en laine fait la part belle aux détails raffinés, pour remettre un classique féminin au goût du jour. Confectionné dans un mélange soyeux de laine et de cachemire, il présente une profonde découpe en pointe à l'encolure, des poches plaquées et un boutonnage sur le devant. L'étoffe sombre de la
  • The Kooples - Robe longue écrue boutonnée à broderies - FEMME
    Cette robe longue d'été est placée sous le signe de la tendance romantique et bohème du Printemps-Été 2021. Elle ressemble les détails incontournables de la collection: une encolure en pointe élégante, de longues manches bouffantes et une rangée de boutons recouverts qui descend le long du devant. Son étoffe
  • The Kooples - Cardigan laine cachemire noir broderies - FEMME
    BLA - Ce cardigan en laine fait la part belle aux détails raffinés, pour remettre un classique féminin au goût du jour. Confectionné dans un mélange soyeux de laine et de cachemire, il présente une profonde découpe en pointe à l'encolure, des poches plaquées et un boutonnage sur le devant. L'étoffe sombre de la
  • The Kooples - Robe longue écrue boutonnée à broderies - FEMME
    BEI - Cette robe longue d'été est placée sous le signe de la tendance romantique et bohème du Printemps-Été 2021. Elle ressemble les détails incontournables de la collection: une encolure en pointe élégante, de longues manches bouffantes et une rangée de boutons recouverts qui descend le long du devant. Son étoffe
  • "Piercing Street" "Piercing nez tige courbée Or blanc 14 carats spike"
    "Piercing pour le nez en véritable Or blanc 14 carats, avec une pointe."
  • "Piercing Street" "Piercing nez tige courbée Or jaune 14 carats spike"
    "Piercing pour le nez en véritable Or jaune 14 carats, avec une pointe."
  • "Piercing Street" "Piercing nez tige courbée Or jaune 14 carats spike"
    "Piercing pour le nez en véritable Or jaune 14 carats, avec une pointe."
  • "Piercing Street" "Piercing nez tige courbée Or blanc 14 carats spike"
    "Piercing pour le nez en véritable Or blanc 14 carats, avec une pointe."
  • STREMLER Kit de tringlerie tige fileté D8 avec accessoire - STREMLER - 2837.00.0
    Caractéristiques : - Tringles pour serrures 2 et 3 points - Jeu de tringles filetées Ø 8 mm traité anti-corrosion - Embouts avec protection anti-sciage - Livrées avec guides, gâche et vis
  • U-Power Baskets de sécurité S1P SRC POINT U-Power
    Ces chaussures de sécurité RedLion U-Power POINT sont normées S1P SRC. Elles sont dotées de la technologie anti-fatigue Infinergy® : amorti incroyable, économie d'énergie (55% de l'énergie restituée) et réduction des TMS. Très respirantes (embout AirToe®, tige et doublure), confortables (chaussant évolutif)
  • FAMA INTERNATIONAL Jeu 5 de forets à pointe de centrage (15 20 25 30 35 mm) - FAMMAB - 0317006K
    Jeu 5 de forets à pointe de centrage Wave CutterContenu : 15 20 25 30 35 mm - Pointe de centrage - 2 lames principales - Lame périphérique avec denture - Tige cylindrique déportée - Développement faible de température et longue durée d'utilisation - Pour le perçage de trous, pour les perçages marginaux ainsi
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Beige
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKI Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Bleu Marine
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Bleu Marine - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS BLEU MARINE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Bleu Marine
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Bleu Marine - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS BLEU MARINE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Bleu Marine
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Bleu Marine - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS BLEU MARINE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Rouge
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Rouge - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS ROUGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKI Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKI Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Rouge
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Rouge - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS ROUGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Vert Kaki
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Vert Kaki - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS VERT KAKI Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les
  • Columbia CANYON POINT - Chaussures randonnée Femme cordovan/sunset red
    Les chaussures de randonnée CANYON POINT  de  COLUMBIA sont polyvalentes afin de profiter au maximum de toutes vos activités outdoor. L'ESSENTIEL : Pratique : Active, approche sportive, allure soutenue Terrain : Variés avec peu ou beaucoup de dénivelé Imperméabilité : Oui SPÉCIFICITÉS : Tige :  Tige mi-haute
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Beige
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Violet Prune
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Violet Prune - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS VIOLET PRUNE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Rouge
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Rouge - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS ROUGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Rouge
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Rouge - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS ROUGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui
  • Linnea Drap de bain 100x150 cm 100% coton 550 g/m2 PURE POINTS Beige
    Drap de bain 100x150 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - DRAP DE BAIN 100x150 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui donnent
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Beige
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Beige - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS BEIGE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs vives lui
  • Columbia CANYON POINT - Chaussures randonnée Homme black/squash
    Les chaussures de randonnée CANYON POINT  de  COLUMBIA sont légères, solides et imperméables idéales pour toutes vos activités outdoor. L'ESSENTIEL : Pratique : Active, approche sportive, allure soutenue Terrain : Variés avec peu ou beaucoup de dénivelé Imperméabilité : Oui SPÉCIFICITÉS : Tige :  Tige basse
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les
  • Linnea Serviette de toilette 50x100 cm 100% coton 550 g/m2 PURE POINTS Bleu Marine
    Serviette de toilette 50x100 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Bleu Marine - Fabriqué au Portugal - SERVIETTE DE TOILETTE 50x100 cm, 100 % COTON 550 g/m2 - PURE POINTS BLEU MARINE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et
  • Linnea Drap de douche 70x140 cm 100% coton 550 g/m2 PURE POINTS Orange Butane
    Drap de douche 70x140 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Orange Butane - Fabriqué au Portugal - DRAP DE DOUCHE 70x140 cm, 100 % COTON 550 g/m2 - PURE POINTS ORANGE BUTANE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs
  • Linnea Serviette invité 33x50 cm 100% coton 550 g/m2 PURE POINTS Marron Taupe
    Serviette invité 33x50 cm PURE POINTS, éponge 100% coton 550 g/m2, broderies - Marron Taupe - Fabriqué au Portugal - SERVIETTE INVITE 33x50 cm, 100 % COTON 550 g/m2 - PURE POINTS MARRON TAUPE Apportez une touche d'élégance à votre salle de bain avec la collection Pure Points. Les points brodés et les couleurs