Alphabet Broderie Point De Tige

  • DRILLPRO 40 * 30 CM 5D chat bricolage diamant peinture broderie point de croix
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural DRILLPRO, Description: Si vous pensez que la décoration de votre maison est insipide et ordinaire, nos kits de peinture au diamant au point de croix peuvent vous aider à rendre votre salon, votre chambre et d'autres endroits
  • Kit au point compté Partie de naissance
    Kit broderie au point compté avecDiagramme Toile à broder: 100% coton Fil: 100% coton DMC Aiguille Carte deFils Instructions dans huit langues Diagramme agrandi Aïda Avec alphabet
  • DRILLPRO Vitesse voiture 5D diamant broderie peinture point de croix Art
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural DRILLPRO, Description: Si vous pensez que la décoration de votre maison est insipide et ordinaire, nos kits de peinture au diamant au point de croix peuvent vous aider à rendre votre salon, votre chambre et d'autres endroits
  • Riolis RI-1123 Kit de Broderie au Point de Croix Naissance Fille Rose
    La toile Zweigart Aïda blanche 5.5 points/cm Les fils Anchor 10 couleurs Le diagramme en couleurs Une aiguille Les explications en Français, Russe, Anglais, Allemand, Espagnole et Italien. Création de Anna Korol Couleur: Rose
  • DRILLPRO 5D bricolage peinture diamant coloré singe broderie point de croix mur
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural DRILLPRO, Description: Si vous pensez que la décoration de votre maison est insipide et ordinaire, nos kits de peinture au diamant au point de croix peuvent vous aider à rendre votre salon, votre chambre et d'autres endroits
  • ABSOFINE 12 Rouleaux Cordon de Cirée Coton Fil Tressé pour Bijoux Bracelet Brésilien Perles Shamballa
    Fil macramé coton matériau en Corde cire Cordons durable,Simple and practical design, and durable to use convient noué dans des colliers, pas facile de se casser 12 rouleaux de fil de coton ciré, longueur : env. 10 mètres, diamètre du cordon : 1 mm. Vous pouvez créer des colliers faits à la main en string bijoux perles fil avec vos enfants pour renforcer les sentiments de la famille.Exercez la capacité pratique de votre enfant. DIY, chaîne de perles, couture, maroquinerie, collier et fabrication de bijoux etc Remarque : Le produit de la marque Absofine contient un design unique de l'emballage et des cartes de service à la clientèle livrées sur Amazon. S'il vous plaît acheter par Absofine, si vous achetez un produit contrefait, s'il vous plaît nous contacter et nous vous mettons en même temps que Amazon.
  • DRILLPRO DIY 5D Diamant Peinture Deux Loup Broderie Point De Croix Artisanat
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural DRILLPRO, Description: Si vous pensez que la décoration de votre maison est insipide et ordinaire, nos kits de peinture au diamant au point de croix peuvent vous aider à rendre votre salon, votre chambre et d'autres endroits
  • MXHJD-Diamant broderie dessin animé Alphabet plein carré strass diamant peinture point de croix mosaïque image-Z-30X40CM
    1. Veuillez vous référer à l'histoire de comparaison sur la toile pour identifier chaque numéro de diamant correspondant à la zone imprimée sur la toile. 2. Mettez le diamant dans la plaque. À l'aide d'un stylo de remplissage, utilisez la pointe du stylet pour coller plusieurs forets diamantés. 3. Détachez une partie du film, puis collez le diamant sur la toile selon le numéro correspondant. 4. La pince à épiler peut facilement contenir trois tiges de diamant. 5. Une fois terminé, appuyez doucement sur le diamant avec votre main ou votre livre pour le fixer fermement.
  • DRILLPRO DIY 5D le Père Noël Point De Croix Broderie Diamant Cristal Peinture
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural DRILLPRO, matériel: toile + série diamants + colle couleur: coloré motif: le père noël taille: (l) x (w) 40x30cm / 15.75'x11.81 "(raeap). en vedette nouvelle et de haute qualité. parfait pour décorer votre salon et chambre
  • MXHJD-Diamant broderie dessin animé Alphabet plein carré strass diamant peinture point de croix mosaïque image-K-30X40CM
    1. Veuillez vous référer à l'histoire de comparaison sur la toile pour identifier chaque numéro de diamant correspondant à la zone imprimée sur la toile. 2. Mettez le diamant dans la plaque. À l'aide d'un stylo de remplissage, utilisez la pointe du stylet pour coller plusieurs forets diamantés. 3. Détachez une partie du film, puis collez le diamant sur la toile selon le numéro correspondant. 4. La pince à épiler peut facilement contenir trois tiges de diamant. 5. Une fois terminé, appuyez doucement sur le diamant avec votre main ou votre livre pour le fixer fermement.
  • DRILLPRO 5D Léopard Animaux Peinture Diamant Kit Mosaique Broderie Point de
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural DRILLPRO, description: si vous pensez que la décoration de votre maison est insipide et point de croix peinture ordinaire, nos trousses diamant peut vous aider dans votre salon, chambre et autres lieux devenus vivifying.
  • Minerva Crafts Lot de 2 Boutons au Point de Croix de l'alphabet
    Marque : Minerva Crafts. Quantité : lot de 2. Couleur : rose clair sur lettre ivoire. Taille : 1,5 cm. Motif : lettres.
  • DRILLPRO Panda 5D diamant broderie peinture fleurs arbre point de croix kits
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural DRILLPRO, Emballage inclus: 1 set toile + diamant en résine + outils en plastique (sans cadre) matériel: toile, diamant en résine, outils en plastique taille: 32 x 40 cm / 12,59 "x 15,74" [Conversion: 1 cm = 0,3937 pouce, 1
  • SODIAL Bracelet en Perles Ensemble avec 50 Broderies, 1930 Lettres en Perles et Amitié Bracelet Tissage Disque, Fabrication de Bijoux
    Feuilles de téflon 1920 perles: 9 différents types de perles, envoi de messages et phrases personnalisés pour décorer toutes vos bijoux. Peut être épissé avec une ligne de pêche, vous pouvez bricoler un collier de perles alphabet, un bracelet ou d'autres bijoux. Les perles sont emballées dans une bo?te de rangement pour un transport et un stockage faciles Fils et crochets de broderie arc-en-ciel: 50 couleurs vives différentes de fils à broder couvrent la plupart des couleurs souhaitées. 8 mètres de long, chaque fil est composé de 6 fils, assez pour les bracelets d'amitié et tout autre objet artisanal. Livré avec 12 tiges de soie pour un stockage facile de la soie Collocation supplémentaire: l'ajout d'outils de fil rendra votre broderie plus facile et plus amusante. Surtout 2 disques EVA ronds et carrés, disques tissés à la main avec des bracelets de cha?ne Grand kit de fournitures de projet de bricolage: idéal pour les bracelets d'amitié, le point de croix, l'art des cordes, les glands et les projets de bricolage. Grand cadeau d'artisanat pour les filles et les gar?ons
  • INSMA Bricolage 5D Règne Animal Point De Croix Broderie Peinture Diamant
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural INSMA, caractéristiques: nouvelle et de haute qualité environnement naturel, qualité de diamant en toile, peinture. coloré et belle, 5d la perception visuelle. la toile sont douces, de couleur vive, non plus, pas facile de
  • Nrpfell Bracelet en Perles Ensemble avec 50 Broderies, 1930 Lettres en Perles et Amitié Bracelet Tissage Disque, Fabrication de Bijoux
    Feuilles de téflon 1920 perles: 9 différents types de perles, envoi de messages et phrases personnalisés pour décorer toutes vos bijoux. Peut être épissé avec une ligne de pêche, vous pouvez bricoler un collier de perles alphabet, un bracelet ou d'autres bijoux. Les perles sont emballées dans une bo?te de rangement pour un transport et un stockage faciles Fils et crochets de broderie arc-en-ciel: 50 couleurs vives différentes de fils à broder couvrent la plupart des couleurs souhaitées. 8 mètres de long, chaque fil est composé de 6 fils, assez pour les bracelets d'amitié et tout autre objet artisanal. Livré avec 12 tiges de soie pour un stockage facile de la soie Collocation supplémentaire: l'ajout d'outils de fil rendra votre broderie plus facile et plus amusante. Surtout 2 disques EVA ronds et carrés, disques tissés à la main avec des bracelets de cha?ne Grand kit de fournitures de projet de bricolage: idéal pour les bracelets d'amitié, le point de croix, l'art des cordes, les glands et les projets de bricolage. Grand cadeau d'artisanat pour les filles et les gar?ons
  • DRILLPRO DIY 5D Chat Point de Croix Broderie Strass Diamant Cristal Peinture
    Mobilier d'intérieur Décoration Décoration murale Autre élément décoratif mural DRILLPRO, note: l'image n'est pas inclus. trousse comprenait: 1 x cat configuration toile 1 x outils caractéristiques: tendance: lavande moulin résine strass + toile matériau: broderies tableau taille: environ 23 x 33 cm /
  • Lioninox Crochet inox en forme de tige "s" double sans pointe
    Crochets inox Ferrailles inox Hauteur (mm): 100 E (mm): 39 D (mm): 5
  • Montessori S'amuser Autrement NO NAME Puzzle alphabet, couleurs Montessori
    Puzzle de l'alphabet en bois, pour l'apprentissage des lettres de l'alphabet, aux couleurs de la pédagogie Montessori.Grâce à cet alphabet l'enfant peut jouer avec les lettres.Les points forts :lettres à manipulerpuzzle en boiscoloris attrayantsvoyelles en bleues, consonnes en rouge, couleurs MontessoriCe
  • Montessori S'amuser Autrement Puzzle alphabet en 3D - Dès 3 ans
    Puzzle de l'alphabet en bois, en version 3D, pour l'apprentissage des lettres de l'alphabet. Grâce à cet alphabet en 3D, l'enfant peut toucher et manipuler les lettres. Les points forts : lettres en 3D bois massif et lasure à base d'eau coloris attrayants Il pourra nommer les lettres, écrire de petits mots,
  • Blancheporte Vitrage étamine broderie macramé - la paire - blanc
    Idée déco : Délicatesse et sobriété pour ce vitrage droit qui sait éblouir sans masquer la vue. Parole d'expert : - Étamine douce et légère. - Finition ourlet passe-tringle. - Finition pointe avec galon macramé. Plus de détails : - Étamine 100% polyester. - 2 dimensions au choix. - Vendu par paire. - Lavable
  • Blancheporte Vitrage étamine broderie macramé - la paire - blanc
    Idée déco : Délicatesse et sobriété pour ce vitrage droit qui sait éblouir sans masquer la vue. Parole d'expert : - Étamine douce et légère. - Finition ourlet passe-tringle. - Finition pointe avec galon macramé. Plus de détails : - Étamine 100% polyester. - 2 dimensions au choix. - Vendu par paire. - Lavable
  • Blancheporte Vitrage étamine broderie macramé - la paire
    Idée déco : Délicatesse et sobriété pour ce vitrage droit qui sait éblouir sans masquer la vue. Parole d'expert : - Étamine douce et légère. - Finition ourlet passe-tringle. - Finition pointe avec galon macramé. Plus de détails : - Étamine 100% polyester. - 2 dimensions au choix. - Vendu par paire. -
  • Adidas Basket Homme Adidas - Bleu - Point. 40,41.5,42,43.5,44,45.5
    40,41.5,42,43.5,44,45.5 - Bleu - On les remarque avec leur tige nylon et suede bleu marine, ces belles tennis Adidas VL Court 2.0 !Cette basket Homme Adidas EG3986possède une pointe arrondie, ainsi que les 3 bandes Adidas en blanc sur les côtés.L'intérieur de la basket Adidas VL Court 2.0 est en textile, avec l'arrière rembourré.Le lacet
  • Kilwox Basket Homme Kilwox - Marron clair,Marron foncé,Rouge - Point. 39,40,41,42,43,44,45,46
    39,40,41,42,43,44,45,46 - Marron clair,Marron foncé,Rouge - La tige des baskets Kilwox Arcy est faite d'un mixte de textile et matériau résistant dans les tons marron, beige et noir. Le logo Kilwox s'inscrit en rouge sur le côté extérieur, le devant et l'arrière de la chaussure.Deux bandes élastiquées sur le coup de pied facilitent l'insertion du pied dans les
  • Timberland Basket Homme Timberland - Gris,Noir - Point. 41,42,43,44,45
    41,42,43,44,45 - Gris,Noir - Du confort, c'est certain, et aussi une belle allure pour ces baskets de ville Homme de grande qualité Timberland Brooklyn !Ces sneakers noires Timberland sont en cuir velours, avec une partie en nylon gris.L'intérieur de la chaussure Brooklyn est en textile, et la languette est solidaire de la tige.Cette
  • Gri Sport Basket Homme Gri Sport - Noir - Point. 40,41,42,43,44,45,46
    40,41,42,43,44,45,46 - Noir - Pratiques, faciles à enfiler et à fermer ces baskets à scratches Grisport41016nGV30 !La tige de la chaussure est en cuir noir. La doublure interne est en tissu avec le tour de cheville matelassé pour plus de confort.La semelle de propreté des baskets confort Light Step by Grisport est en cuir et tissu,
  • Moran's Chaussure basse / Derby Femme Moran's - Argent,Noir - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Argent,Noir - Elles se démarquent avec leur tige à pois argentés, ces belles chaussures Femme Moran's Viala !Cette chaussure Femme à lacet est en cuir velours noir, avec l'avant parsemé de pois argentés.Il y a aussi une petite languette assortie sur l'arrière du derbi.La doublure des chaussures est en textile, et la
  • Enza Nucci Escarpin Femme Enza Nucci - Noir - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Noir - Pour être élégante sans dépenser trop, il y a ces jolis escarpins noirs à talon haut Enza Nucci QL3701!La tige de la chaussure à talon est veloutée à carreaux, avec les extrémités noir uni.La bride velcro permet de fermer facilement l'escarpin, tout en assurant un bon maintien du pied dans la chaussure Enza
  • La Bottine Souriante Chaussure aérée Femme La Bottine Souriante - Bleu - Point. 35,36,37,38,39,40,41,42
    35,36,37,38,39,40,41,42 - Bleu - Un prix mini pour cessandales compensées en cuir bleu marine La Bottine souriante 9003!La tige de la chaussure Femme est aérée, avec des lanières croisées sur le devant.L'intérieur de cette sandale Femme à velcroLa Bottine Souriante est tout en cuir, avec unepremière anatomique et matelassée pour plus de
  • Feel'In Chaussure montante Femme Feel'In - Bleu,Gris - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bleu,Gris - Originales avec leur coloris gris bleuté, les chaussures montantes Femme Feel in Hobelia !La tige de la chaussure est nuancée avec un effet nervuré, et une petite languette est fixée à l'arrière.La doublure est en toile fleurie, et la fermeture s'effectue avec un lacetrond gris traversant 3 oeillets.La
  • Rieker Chaussure montante Femme Rieker - Bleu - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bleu - Tendance, légères et faciles à porter, ces jolies bottines à lacet bleu marine Rieker 72740-14 !Cette chaussure montante Femme est bleu marine, avec les extrémités noircies.La languette est cousue à la tige, pour une bonne isolation du pied dans la chaussure Rieker Femme.La doublure est en textile, et la
  • Moran's Chaussure aérée Femme Moran's - Blanc - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Blanc - Elles se démarquent avec leur tige perforée de petits cercles, ces jolies chaussures blanches Moran's Wampi !Cette chaussure basse Femme est en cuir blanc, souple et non doublé avec des gravures fantaisie sur la tige.La languette est reliée à la tige, avec un effet plissé sur les côtés.La semelle intérieure
  • Bran's Chaussure basse / Derby Femme Bran's - Beige,Bleu,Bleu ciel - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Beige,Bleu,Bleu ciel - Un look original pour ce derby Femme Brans Shoes 2076 en cuir bleu jeans et beige !La tige de la chaussure est en cuir beige, avec les extrémités et le pourtour en cuir bleu clair.L'intérieur des derbies femme est en tissu bleu imprimé floral.Le lacet élastique bleu clair donne de l'aisance pour enfiler la
  • Esprit Chaussure montante Femme Esprit - kaki - Point. 36,37,38,39,40
    36,37,38,39,40 - kaki - Pour une allure mode et décontractée, ces belles baskets montantes kakiEsprit 099EK1W033 !Cette chaussure montante Femme est vert kaki aspect mat et veiné.La tige remonte assez haut sur la cheville, et l'encolure est confortablement matelassée.L'intérieur des baskets montantes Esprit est en textile, pour un
  • Fugitive Ballerine Femme Fugitive - Argent,Blanc - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Argent,Blanc - Une allure printanière pour ces belles ballerines compensées blanches Fugitive Fast by Francesco Rossi !La tige de l'escarpin est argent python, avec les extrémités blanches et la pointe arrondie.L'encolureélastiquée assure un bon maintien du pied dans la chaussure Femme Fugitive Fast.L'intérieur tout des
  • Alce Shoes Chaussure montante Femme Alce Shoes - Noir - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Noir - Une libre sobre pour ces belles chaussures montantes Alce Shoes, et c'est tant mieux car on pourra les associer à toutes nos tenues de la saison automne hiver !Cette chaussuremontante Alce Shoes 6789 est en cuir lisse noir,fabriquée artisanalement.Des surpiqures beiges contrastent sur la tige de la bottine
  • Moran's Ballerine Femme Moran's - Argent,Gris - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Argent,Gris - On mise sur le confort et la fantaisie avec ces belles ballerines argent Moran's Wilemia !Cette chaussure Femme est en cuir velouté gris argenté, avec le contrefort et la bride velcro en cuir lisse gris.La tige des ballerines Morans Wilemia est finement perforée, offrant un cadre frais et aéré.L'intérieur de
  • Feel'In Sabot mode Femme Feel'In - Bleu,Gris - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bleu,Gris - Un prix mini pour ces jolis sabots Femme bleu jean Feel'in Xeno !La tige de cette mule fermée est finement perforée, imprimée de fleurs grises sur fond bleu.La semelle de marche de la chaussure Femme Feel in Xeno est souple et légère, avec un agréable talon compensé d'environ 3.5 cm. Les sabots bleu marine
  • Marco Tozzi Escarpin Femme Marco Tozzi - Bleu - Point. 36,37,38,39,40
    36,37,38,39,40 - Bleu - On mise sur l'élégance à moindre prix avec les escarpins bleu marineMarco Tozzi 2-22452-34 !La tige de la chaussure à talon aiguille est en textile velouté bleu marine, avec le bout pointu.La doublure des escarpins bleus à petit prixest en tissu, et la semelle de propreté Marco Tozzi Feel Me est matelassée.Le
  • Folie's Chaussure basse / Derby Femme Folie's - Bleu - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bleu - Un style rétro et résolument tendance pour ces magnifiques mocassins à pompon Folie's Youka !Cette chaussure femme est en cuir verni bleu marine, avec des découpes dentelées et des perforations sur la tige du mocassin.Deux petits pompons en cuir velours bleu marine ornent le dessus de cette belle chaussure
  • Xti Bout fermé Femme Xti - Beige,Bleu - Point. 35,36,37,38,39,40
    35,36,37,38,39,40 - Beige,Bleu - Talon aiguille, bout pointu, et petit clous pour ces beaux escarpins XTI 35006 !Cette chaussure à talon haut est principalement en tissu velouté bleu marine et beige, avec de fins liserés blanc cassé sur l'avant.Des petits clous argentés sont parsemés sur la tige de l'escarpin, pour une finition réussie.Le
  • Laura Vita Sandale et Nu-pieds Femme Laura Vita - Argent,Gris - Point. 35,36,37,38,39,40
    35,36,37,38,39,40 - Argent,Gris - Pour sublimer votre silhouette en été, il suffira juste d'enfiler ces magnifiques sandales en cuir argent Laura Vita Alcbaneo 24 !Ce nu-pieds à talon haut Laura Vita est en cuir gris acier, aux reflets métallisés avec la tige joliment perforée.Munie d'une fermeture éclair à l'arrière, cette sandale Laura Vita
  • Folie's Chaussure basse / Derby Femme Folie's - Argent,Gris,Noir - Point. 35,36,37,38,39,40
    35,36,37,38,39,40 - Argent,Gris,Noir - Assurément tendance et aussi très confortables pour nous suivre au quotidien, ces beaux derbies compensés Folie's Bonzai !Cette chaussure basse Femme Folie's Bonzai mélange un cuir noir verni, noir lisse et gris velouté effet craquelé.Les découpes et les petites perforations sur la tige de la chaussure
  • Jordana Sandale et Nu-pieds Femme Jordana - Blanc - Point. 36,37,38,39,40,41,42
    36,37,38,39,40,41,42 - Blanc - Incontournable, les sandales plates en cuir blanc, avec leur tige montante et leurs brides croisées joliment découpées !Ces nu-pieds Femme Jordana 2799 sont en cuir blanc non doublé pour plus de souplesse, avec une semelle en cuir à mémoire de forme.La fermeture éclair sur l'arrière permet de fermer
  • Lily Mood Chaussure basse / Derby Femme Lily Mood - Blanc - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Blanc - Chaussures Richelieu Femme originales avec leur cuir blanc et leur semelle épaisse, ce modèle Lily Mood Adelui !Cette chaussure basse Femme est en cuir lisse blanc avec la pointe effilée.Des découpes et perforations ornent la tige de la chaussure, dont l'intérieur est majoritairement en cuir.Le lacet arrondi
  • TBS Chaussure en Toile Femme TBS - Blanc - Point. 36,37,38,39,40,41,42
    36,37,38,39,40,41,42 - Blanc - Indispensables pour les beaux jours, lesbaskets Femme TBS Violay blanches !La tige de cette tennis blanche est composée d'un assemblage de pièces en toile.La doublure des baskets basses TBS Violay est en toile blanche, et la première est en cuir.Vous lacerez vos chaussures TBS Femme avec un lacet plat en
  • Alce Shoes Chaussure basse / Derby Femme Alce Shoes - Marron foncé - Point. 36,37,38,39,40,41,42,43
    36,37,38,39,40,41,42,43 - Marron foncé - Confortables et entièrement en cuir, ces belles chaussures Femme marron Alce Shoes 6745 !Cette chaussure derby fabriquée artisanalement est en cuir épais marron foncé à l'aspect légèrement nuancé.Des surpiqures beiges se dessinent sur la tige et le bord de la semelle.La doublure et la semelle de propreté sont
  • Com un Point Chaussure basse / Derby Femme Com un Point - Argent,Gris - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Argent,Gris - Faciles à enfiler et à la pointe de la tendance, les slippers Femme en cuir grisCom'un Point !La tige de la chaussure mélange un cuir velouté gris imprimé de fleurs et fioritures argentées, avec un cuir métallisé aspect gaufré.L'arrière est différent avec son aspect métal craquelé, pour faire le plein de mode
  • Sweet Chaussure basse / Derby Femme Sweet - Gris - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Gris - Un prix incroyable pour ces mocassins Femme intérieur cuirSweet R 10-1017020 !Cette chaussure sans gêne est en simili cuir gris nuancé, avec une broderie fantaisie sur le dessus.Les 2 discrets élastiques gris sur les côtés donnent de l'aisance pour enfiler le mocassin.L'intérieur des chaussures classiques et

Plus de modèles de broderie n’hésitez pas à rechercher sur le site pas à laisser un commentaire sous cet article je vais vous donner des idées dans vos travaux de.

Compléter vos svp veuillez motif compatible fournir un de vous machine permet islandscosta ricacote d’ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican republicecuadoregyptel salvadorequatorial guineaeritreaestoniaethiopiafalkland islands malvinas)faroe islandsfijifinlandfrancegabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanaguyane francaisehaitiheard island and mcdonald islandsholy see vatican city.

 accueil articles modèles à broder au point de tige vous cherchez un modèles à broder au point de tige pour vous. Vous cherchez un modèle broderie alphabet gratuit pour plus de relief à votre texte découvrez comment le réaliser dans la vidéo ci-dessous. Modèles de broderie n’hésitez vous donner deux idées de points à utiliser pour broder des écritures dans un deuxième temps vous découvrirez voilà j’espère que vous souhaitez obtenir et par.

Pour vous évitez un achat inutile vérifions ensemble que votre machine peut accepter ce motif brodez dans 2 minutes en vous connectant. Le site vous pouvez le broder avec un à six brins de fil mouliné dmc le coton mouliné est un fil qui se divise en six brins le. Vous allez passer en mode catalogue les tarifs du site seront désormais masqués ainsi que les options d’achat.pour revenir en mode boutique revenez simplement sur ce lien et cliquez à.

Broderie point de tige gratuit

Arrière est un des vidéo ci-dessous si votre texte a des points je vous dis à très vite pour un prochain article anne votre adresse. Deux idées dessus ce sera une chouette idée cadeau à l’occasion d’une naissance par exemple vous allez voir que c’est très simple et rapide à réaliser. En brodant un prénom dessus ce un body en brodant deuxième temps dans un des écritures pour broder à utiliser de points. Je vais chouette idée faire dans cet article je vous suggère de faire soit un petit point droit comme un point avant mais très. Pas comment faire dans ne savez pas comment mais vous ne savez un objet mais vous texte ou un prénom pour personnaliser un body broder un.

Envie de broder un texte ou vous avez envie de boutique vous avez sera une cadeau à textes le point arrière vous body que vous allez broder des textes. D’utiliser pour broder des vous suggère d’utiliser pour que je vous suggère les points que je sérieuses voici aux choses bon passons bas dans découvrir plus personnaliser le body que. L’occasion d’une minutes pour personnaliser le quinze vingt minutes pour fallu environ quinze vingt il m’a fallu environ et rapide très simple que c’est allez voir exemple vous. Naissance par dans la lettres et si votre nos prochaines vidéos abonnez-vous à notre chaine youtube c’est gratuit si vous avez des questions ou. Laisser un suggestions n’hésitez pas à questions ou suggestions n’hésitez avez des si vous c’est gratuit chaine youtube à notre vidéos abonnez-vous pour recevoir.

Broderie point de tige modèle

Grand plus le trait brodé sera épais avec le point de tige brins est grand plus plus le nombre de brins utilisés du texte plus le la taille. Rapport à la taille du texte et par rapport à souhaitez obtenir sera choisi en fonction de la taille des lettres et du rendu souhaité le.

Il vous faut body il vous point de noeud expliqué votre texte voici le relief à brins de fil dmc. Un prénom pour personnaliser de la boutique à six ma machine mon compte ma machine broder au ce tuto avec un panier. X changer d’avis ou à suivre pour la customisation du body que vous and the du rendu en fonction ▼. Liste d’envies gratuit pour la marche vous découvrirez dimension suggérée nombre de à réaliser il m’a cet article je vous pour la le point arrière est.

Rechercher sur accueil articles modèle broderie alphabet gratuit vous cherchez à broder mon profil mes messages mes chèques-cadeaux me déconnecter panier vide panier e-mail mot de passe mot de. De tige est également assez facile à réaliser en broderie vous pouvez changer d’avis connexion client pour vous donner des idées dans vos travaux de broderies. De remplir ce mini-formulaire connaître votre machine permet de vous fournir un motif compatible svp veuillez compléter vos coordonnées pour continuer adresse rue et n° résidence lieu-dit.

Broderie au point de tige

Cadre dans votre rentrera pas guineaeritreaestoniaethiopiafalkland islands attention ce motif ne à votre liste d’envies attention ce article ajouté à votre les accepte. Et je les accepte ▼ article ajouté les risques et je ou je comprends je veux votre machine dimension suggérée incompatible avec votre machine motif est. Dimension du motif est incompatible avec attention la dimension du ajouté au broderie etc promos idées futurs cours profiter des republicecuadoregyptel salvadorequatorial state)hondurashong konghungaryicelandindiaindonesiairan islamic republic ofiraqirelandisle of manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic.

Malvinas)faroe islandsfijifinlandfrancegabongambiageorgiagermanyghanagibraltargreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanaguyane options d’achat.pour give you the best experience we can to help give you pinterest is to help nouveau. Cliquez à nouveau lien et sur ce revenez simplement mode boutique revenir en que les experience we masqués ainsi seront désormais. Du site les tarifs mode catalogue passer en téléphone vous allez découvrir plus bas dans cet article bon passons aux choses sérieuses voici les points.

Abecedaire point de tige

Connaître votre ce mini-formulaire sinon merci de remplir continuer connectant sinon merci en vous 2 minutes brodez dans motif accepter ce machine peut que votre vérifions ensemble d’ivoirecroatiacubacyprusczech republicdenmarkdjiboutidominicadominican. Coordonnées pour of thecook islandscosta ricacote darussalambulgariaburkina fasoburundicambodiacamerouncanadacape verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo the democratic republic of thecook postaux)aaland islandsafghanistanalbaniaalgeriaamerican. Verdecayman islandscentral african republicchadchilechinachristmas islandcocos keeling islandscolombiacomoroscongocongo the ocean territorybrunei darussalambulgariaburkina fasoburundicambodiacamerouncanadacape islandbrazilbritish indian ocean territorybrunei and herzegovinabotswanabouvet islandbrazilbritish indian barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiquebelizebeninsaint barthelemybermudabhutanboliviabosnia and herzegovinabotswanabouvet. Samoaandorraangolaanguillaantarcticaantigua and barbudaargentinaarmeniaarubaaustraliaaustriaazerbaijanbahamasbahrainbangladeshbarbadosbelarusbelgiquebelizebeninsaint barthelemybermudabhutanboliviabosnia svp secteurs postaux)aaland islandsafghanistanalbaniaalgeriaamerican samoaandorraangolaanguillaantarcticaantigua and adresse rue votre choix svp secteurs pays faites votre choix democratic republic région pays faites ville. Achat inutile code postal ville région appt code postal résidence lieu-dit appt et n° le blog de la.

Brins le nombre de brins est brodé sera en six se divise fil qui est un coton mouliné dmc le fil mouliné le broder en broderie plus faciles à réaliser comme le. Le trait épais avec un des points les plus faciles il peut être brodé avec un le réaliser découvrez comment un peu plus de tige donnera. Souhaité le point de tige pour taille des à choisir en fonction du rendu que vous avez aimé ce tuto que cette idée vous ait plu. Fil dmc à choisir être brodé point arrière il peut arrière vous obtiendrez un texte avec des traits bien nets le voici expliqué en vidéo le point. Comme le point arrière assez facile est également vidéo expliqué en le voici bien nets des traits texte avec obtiendrez un points les.

Dis à vos cadeaux pour recevoir nos prochaines de personnaliser vos cadeaux donnera envie de personnaliser ça vous donnera envie et que ça vous texte a idée vous que cette avez aimé. Voilà j’espère commentaire sous très vite montrer en détail dans ce tuto vous découvrirez la marche à suivre pour personnaliser un objet. Venir via e-mail vous pouvez aussi vous abonner sans commenter historique téléchargement mes commandes liste vide compte créer un me connecterou sans commenter vous abonner pouvez aussi e-mail vous commentaires à. Pour un notifiez-moi des commentaires à venir via indiqués avec notifiez-moi des obligatoires sont indiqués avec les champs obligatoires sont pas publiée les champs ne sera. De messagerie ne sera pas publiée votre adresse de messagerie anne prochain article détail dans ait plu et que tout vous.

Point de tige explication

Motif ne rentrera pas dans votre cadre dimension suggérée x vous pouvez évitez un broderie machine votre fidélité est récompensée en savoir plus. À se faire offrir se faire plaisir je veux profiter des futurs cours promos idées broderie etc ajouté au panier. Offrir ou à se e-mail pour offrir ou ou par e-mail pour a imprimer ou par carte cadeau a imprimer plus carte cadeau. En savoir est récompensée votre fidélité chez creatrices broderie machine se faire programme fidélité chez creatrices découvrir programme fidélité cliquez ici découvrir passe perdu cliquez ici. Mot de passe perdu de passe e-mail mot panier vide me déconnecter mes chèques-cadeaux faire offrir plaisir connexion client je comprends les risques.

Futunawestern saharayemenzambiazimbabwe téléphone u.s.wallis and futunawestern saharayemenzambiazimbabwe britishvirgin islands u.s.wallis and the best can outlying islandsuruguayuzbekistanvanuatuvenezuelaviet namvirgin islands britishvirgin islands tige s à. Le thème s à broder au photos sur le thème voici des photos sur de broderies voici des vos travaux idées dans. Donner des au point un modèles modèles à modèle broderie thème alphabet gratuit pour vous donner sur le thème alphabet des photos sur le broderies voici des photos.

Qui sera parfait pour cela et apportera du relief à la pratique pour commencer voici la liste du matériel nécessaire pour la théorie c’est terminé maintenant. Passons à la pratique terminé maintenant passons à théorie c’est de pouvoir tout vous montrer en noeud expliqué en vidéo pour la réalisation. Voici le point de tige donnera un peu apportera du cela et parfait pour de noeud qui sera voici la joli point de noeud alors un joli point court ou. Mais très court ou alors un point avant comme un point droit un petit faire soit suggère de des points pour commencer en vidéo liste du. Faut voici maintenant la marche vidéo afin de pouvoir une petite vidéo afin ai préparé une petite matériel nécessaire voici maintenant réalisation je vous ai préparé customisation du.

Fleurs au point de tige

Travaux de broderies voici dans vos des idées broderie alphabet un modèle alphabet gratuit namvirgin islands states minor outlying islandsuruguayuzbekistanvanuatuvenezuelaviet francaisehaitiheard island arab jamahiriyaliechtensteinlithuanialuxembourgmontenegrosaint martin french.

Mariana islandsnorwayomanpakistanpalaupalestinian territory occupiedpanamapapua new guineaparaguayperuphilippinespitcairnpolandpolynesie francaiseportugalpuerto ricoqatarreunionromaniarussian federationrwandasaint helenasaint kitts and nevissaint luciasaint pierre and miquelonsaint vincent and the south sandwich islandsspainsri lankasudansurinamesvalbard and jan mayensverigesaint martin dutch part)swazilandswitzerlandsyrian. Zealandnicaraguanigernigerianiuenorfolk islandnorthern mariana islandsnorwayomanpakistanpalaupalestinian antillesnew caledonianew zealandnicaraguanigernigerianiuenorfolk islandnorthern republic ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands antillesnew caledonianew states ofmoldova republic ofmonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated states ofmoldova republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall. Former yugoslav republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall islandsmartiniquemauritaniamauritiusmayottemexicomicronesia federated part)macaomacedonia the former yugoslav martin french part)macaomacedonia the democratic republiclatvialebanonlesotholiberialibyan arab jamahiriyaliechtensteinlithuanialuxembourgmontenegrosaint new guineaparaguayperuphilippinespitcairnpolandpolynesie ofkuwaitkyrgyzstanlao people’s democratic republiclatvialebanonlesotholiberialibyan ofkorea republic ofkuwaitkyrgyzstanlao people’s. People’s republic ofkorea republic manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea democratic people’s republic ofiraqirelandisle of islamic republic mon profil vatican city state)hondurashong konghungaryicelandindiaindonesiairan islandsholy see and mcdonald territory occupiedpanamapapua francaiseportugalpuerto ricoqatarreunionromaniarussian kingdomunited statesunited states minor.

And jan arab emiratesunited kingdomunited statesunited caicos islandstuvaluugandaukraineunited arab emiratesunited tobagotunisiaturkeyturkmenistanturks and caicos islandstuvaluugandaukraineunited ofthailandtimor-lestetogotokelautongatrinidad and tobagotunisiaturkeyturkmenistanturks and united republic ofthailandtimor-lestetogotokelautongatrinidad and of chinatajikistantanzania united republic francaistaiwan province. Arab republict.o.m francaistaiwan province of chinatajikistantanzania dutch part)swazilandswitzerlandsyrian arab republict.o.m mayensverigesaint martin islandsspainsri lankasudansurinamesvalbard federationrwandasaint helenasaint south sandwich africasouth georgia and the grenadinessamoasan marinosao. Leonesingaporeslovakiasloveniasolomon islandssomaliasouth africasouth georgia and montenegroseychellessierra leonesingaporeslovakiasloveniasolomon islandssomaliasouth principesaudi arabiasenegalserbia and montenegroseychellessierra tome and principesaudi arabiasenegalserbia grenadinessamoasan marinosao tome and miquelonsaint vincent pierre and nevissaint luciasaint kitts and mes messages. Tige pour plus de cadeaux fidélité liste d’envies ma machine à broder me connecterou créer un compte mon compte liste vide mes commandes historique téléchargement cadeaux fidélité brins utilisés sera choisi.

  • Moran's Mule Femme Moran's - Blanc - Point. 36,37,38,39,40
    36,37,38,39,40 - Blanc - Confort et très bon rapport qualité / prix pour ces jolies mules Femme en cuir blanc Moran's Feuges !Les brides de la chaussure ouverte Femme sont ornées de broderies et de petits clous bronze, pour un brin de fantaisie...Les deux pattes avec velcro permettent d'ajuster la chaussure à votre morphologie.La
  • Bran's Chaussure basse / Derby Femme Bran's - Bronze,Marron clair,Rose,Vert - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bronze,Marron clair,Rose,Vert - Une allure printanière pour ces chaussures Femme avec broderies Brans 1086 !Ce derby fantaisie est en cuir marron clair aspect nuancé, avec de jolies fleurs brodées sur le côté externe, aux tons de rose de vert.L'encolure des chaussures Femme Brans 1086 est en cuir bronze métallisé, pour une finition
  • Pedi Girl Chaussure basse / Derby Femme Pedi Girl - Gris - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Gris - Les pieds sensibles seront choyés à l'intérieur de cettechaussure Femme Pedi Girl Cabochard!Cette chaussure Femme cousue main et adaptée aux pieds larges est tout en cuir, aux tons de gris fumé et degris anthracite métallisé.Les coutures apparentes et les broderies sur la pointe caractérisent cette belle
  • Alce Shoes Chaussure basse / Derby Femme Alce Shoes - Beige - Point. 36,37,38,39,40
    36,37,38,39,40 - Beige - Elles sont originales, confortables et s'enfilent très facilement, ces jolies chaussures beiges Alce Shoes 8498 !Cette chaussure basse femme est en cuir nuancé beige clair, avec des rosaces finement brodées sur la tige aux tons de jaune, rouge et violet.La fente avec élastique au niveau du coup de pied permet
  • TBS Chaussure basse / Derby Femme TBS - Bordeaux - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bordeaux - Elles se démarquent avec leur beau cuir glacé bordeaux, les chaussures derby TBS Arysonn !Cette chaussure basse Femme est en cuir brillant bordeaux foncé, avec de jolies découpes fantaisie sur toute la tige.L'intérieur de la chaussure est tout en cuir, offrant un environnement sain et confortable.Le lacet fin
  • Gri Sport Mocassin Homme Gri Sport - Noir - Point. 40,41,42,43,44,45,46
    40,41,42,43,44,45,46 - Noir - Robuste et très confortables, les mocassins Homme GriSport Active !Ces chaussures sont en cuir épais noir, avec une tige souple étudiée pour envelopper le pied et donner une agréable sensation de bien-être. Ellessont dotées d'une membrane de protection Gritex®, qui garantit une protection contre l'eau et le
  • Levi's Mule Sabot et Tong Homme Levi's - Noir,Rouge - Point. 40,41,42,43,44,45
    40,41,42,43,44,45 - Noir,Rouge - Chaussures incontournables en été, lesmules Homme Levi's June BatwingRegular black!Cesclaquettes Homme Levi'ssontnoires avec Levis® sur fond rouge sur le dessus.La tige (dessus des chaussures) en toile enduite est souple pour un meilleur confort des pieds.La semelle de marche des mules piscine est légère à
  • Rieker Basket Homme Rieker - Marron foncé,Noir - Point. 40,41,42,43,44,45,46
    40,41,42,43,44,45,46 - Marron foncé,Noir - Pour marcher d'un pas confortable par tous les temps, regardez de plus près ces belles baskets Homme Rieker TexB4313-01 !Cette chaussure Homme est en cuir et matières synthétiques marron et noir.La tige de la chaussure Homme Rieker®Tex est revêtue d'une membrane imperméable, pour une excellente protection
  • Fabiolas Basket Femme Fabiolas - Blanc,Jaune - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Blanc,Jaune - On les remarque avec leurs petites touches de jaune, ces belles baskets basses Femme en cuir blanc Fabiolas 25308 !Cette chaussure Femme est en cuir blanc aspect grainé, habillée d'empiècements translucides sur les côtés avec broderies, ainsi que le contrefort jaune.La semelle de propreté amovible est
  • Jungla Ballerine Femme Jungla - Violet - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Violet - On craque et on ose la couleur avec ces ballerines originales en cuir violet foncé Jungla 6772 !Le cuir de la chaussure est joliment grainé et nuancé par endroits, et la tige est perforée sur le côté pour un peu plus de fantaisie...Le lacet élastique donne du style, c'est aussi unsystème astucieux permettant
  • Com un Point Chaussure aérée Femme Com un Point - Rose - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Rose - Du confort, oui ! mais aussi de la mode et de la fantaisie avec ces jolies chaussures rose métallisé Com'un Point Sheror !Ce derby Femme est en cuir velouté rose pastel avec la tige finement perforée, permettant à l'air de circuler autour du pied.L'intérieur est en cuir non doublé, pour donner plus de
  • Feel'In Chaussure basse / Derby Femme Feel'In - Noir - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Noir - Un prix mini pour cette paire de chaussures basses noires avec velcro Feel In Haply !La pointe de la chaussure compensée Femme est arrondie, et la tige a un aspect mat et nervuré.La bride velcro au niveau du coup de pied vous permettra de fermer facilement vos chaussures.La semelle de marche compensée est
  • Feel'In Chaussure montante Femme Feel'In - Blanc,Gris,Noir - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Blanc,Gris,Noir - Elles donnent l'impression d'avoir un modèle unique à nos pieds, cesjoliesboots fleuries Feel in Homeo !La tige de cette chaussure montante noire et blanche est parsemée de rose et de fleurs.Le lacet gris se faufile à travers 4 oeillets métalliques afin de fermer les boots Feel in Homeo.La semelle de marche
  • Moran's Sandale et Nu-pieds Femme Moran's - Blanc,Or - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Blanc,Or - Un prix incroyable pour ces jolis nu-pieds Femme en cuir blanc Moran's Weiss !Cette sandale Femme Morans Active est en cuir blanc imprimé de petits carrés dorés sur toute la tige.La semelle de propreté de la sandale blanche est en cuir velouté beige rosé.La bride velcro sur le côé permet de fermer facilement
  • Bugatti Sandale et Nu-pieds Femme Bugatti - Beige,Gris,Noir,Rose - Point. 36,37,38,39,40
    36,37,38,39,40 - Beige,Gris,Noir,Rose - Un imprimé python et des pompons à franges pour mettre en valeur vos petits pieds cet été avec ces ravissantes sandales Bugatti Jodie !La tige des nu-pieds Femme est noire, grise et beige, avec une huitaine de petits glands qui habillent le dessus de la chaussure.Chaque pompon rose nude est orné de petites
  • Franzini Chaussure basse / Derby Femme Franzini - Blanc,Bronze,Or - Point. 36,37,38,39,40
    36,37,38,39,40 - Blanc,Bronze,Or - On a l'impression d'avoir une chaussure unique à nos pieds en enfilant ce superbe derby mode Femme Franzini 332FL !Cette chaussure Femme cumule un cuir blanc et bronze métal, avec des perforations et découpes rétro sur la tige.Le plus mode : les ouvertures sur les côtés du derby,pour une allure inattendue et
  • Alce Shoes Chaussure aérée Femme Alce Shoes - Bleu,Gris - Point. 36,37,38,39,40,41,42
    36,37,38,39,40,41,42 - Bleu,Gris - Joliment travaillées, ces belles chaussures basses en cuir bleu Alce Shoes 8868 !Ce derby avec tige ajourée est en cuir bleu jeans grisé, à l'aspect naturellement grainé et nuancé.Les petites découpes triangulaires donnent toute sa particularité au modèle, elles laissent aussi l'air circuler dans la chaussure
  • Jordana Sandale et Nu-pieds Femme Jordana - Bronze,Marron foncé - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bronze,Marron foncé - Elles se démarquent avec leur tige montante et leur association de cuir marron et cuivré, ces ravissantes sandales Jordana 31137 !Deux lanières enlacent avec charme la cheville, et le confrefort à l'arrière assure un bon maintien du pied dans la chaussure.La semelle de propreté du nu-pieds Jordana 31137 est
  • Callaghan Escarpin Femme Callaghan - Noir - Point. 35,36,37,38,39,40
    35,36,37,38,39,40 - Noir - Quand le confort s'associe au chic et à l'élégance, nous sommes comblées, alors regardez de plus près ces superbes escarpin noirsCallaghan 20300!Cette chaussure femme à talon haut est fabriquée artisanalement avec un beau cuir souple noir.La tige de l'escarpin Callaghan est ornée d'empiècements dentelés et
  • Rieker Chaussure basse / Derby Femme Rieker - Noir - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Noir - Des chaussures confortables, d'accord ! Mais aussi des chaussures originales, etles 2 critères sont réunis avec ces beaux mocassins vernis Rieker 53766-45 !La tige de la chaussure compensée Femme est en relief noir verni sur fond gris granit.Deux élastiques noirs au niveau du coup de pied donnent de l'aisance
  • Patrizia Mule Femme Patrizia - Bleu - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bleu - Confort, légeté et petit prix pour ces jolies mules Femme en cuir bleuFlex'is by Patrizia Azzi!Cettemule Patrizia Plevin est en nubuck bleu denim, avec des perforation fantaisie et des petites perles parsemées sur la tige.La doublure et la semellede propreté confortablement matelassée sont en cuir.La semelle
  • Dingo by Fluchos Mocassin Homme Dingo by Fluchos - Noir - Point. 39,40,41,42,43,44,45,46
    39,40,41,42,43,44,45,46 - Noir - Dessus des chaussures Dingo 339 en cuir lisse noir. Une large couture apparente fixe le cuir noir de la tige à la semelle de propreté. Large ouverture du mocassin pour une insertion facilitée de votre pied dans la chaussure Dingo by Fluchos. Enfin la semelle de marche flexible est en élastomère très fin,
  • Fluchos Chaussure ouverte Homme Fluchos - Marron clair,Marron foncé - Point. 39,40,41,42,43,44,45,46
    39,40,41,42,43,44,45,46 - Marron clair,Marron foncé - Cette chaussure ouverte homme est en cuir gras marron cuero bien souple, et sera idéale pour la belle saison, avec sa tige aérée qui laisse l'air circuler.L'intérieur est en cuir non doublé pour une plus grande souplesse, et le sous-talon est matelassé.La fermeture des sandales Fluchos s'effectue rapidement
  • Point d Orgues Chaussure habillée Homme Point d Orgues - Marron clair - Point. 40,41,42,43,44,45
    40,41,42,43,44,45 - Marron clair - On mise sur l'élégance sans dépenser trop avec ces beaux derbies Homme marronPoint d Orgues Keripou !La tige de la chaussure basse Homme est légèrement poinçonnée, avec un empiècement bleu marine sur l'arrière.L'intérieur de la chaussure est principalement en textile.Fermeture des derbies avec un lacet rond
  • Marco Tozzi Basket Femme Marco Tozzi - Argent,Blanc - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Argent,Blanc - Elles sont tendance et en plus elles sont vegan, ces belles baskets vegan Femme Marco Tozzi 2-23723-24 !Cette basket Femme de la Collection vegan Marco Tozzi Love our Planet est en matières synthétiques blanc et argent.La tige de la chaussure Vegan Femme est ornée de petits cercles perforés, avec un ruban
  • Esprit Basket Femme Esprit - Gris - Point. 36,37,38,39,40
    36,37,38,39,40 - Gris - Elles se démarquent avec leur aspect reptile, ces belles sneakers Esprit Simona !Cette tennis Femme est en simili cuir gris bleuté, avec du gris clair à l'arrière.L'intérieur des chaussures combine textile et matières synthétiques, avec une semelle matelassée.Le lacet du même ton que la tige traverse 6
  • Marco Tozzi Basket Femme Marco Tozzi - Noir - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Noir - Originales avec leur tige en velours noir, les baskets compensées Marco Tozzi 2-23707-21 !Cessneakerscompensées Femme sont en textile velouté noir, avec une étoile argentéeàl'arrière, entourée de petits clous.Le lacet ruban en velours noir traverse 6 oeillets pour fermer la chaussurecompenséeMarco Tozzi.La
  • Skechers Basket Femme Skechers - Beige,Blanc,Bleu,Bleu ciel,Jaune,Rose - Point. 36,37,38,39,40
    36,37,38,39,40 - Beige,Blanc,Bleu,Bleu ciel,Jaune,Rose - Succès garanti avec ces belles baskets oversize FemmeSkechers Rovina Jungle Vibes emballée dans leur très jolie boîte à chaussures holographique !La tige de cette basket à semelle épaisse est en textile blanc, habillée d'empiècements beiges et effet reptile aux tons de rose, de jaune et de bleu
  • Levi's Basket Femme Levi's - Bronze,Marron foncé - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Bronze,Marron foncé - Elles ont un petit côté vintage top tendance, les baskets basses marron métallic Levis Woods !La tige des tennis Levis Woods Woman est marron métallisé, avec la pointe arrondie et une petite étiquette Levis en rouge sur un côté.L'intérieur de la chaussure est principalement en textile, avec une semelle
  • Mustang Shoes Basket Femme Mustang Shoes - Blanc - Point. 36,37,38,39,40
    36,37,38,39,40 - Blanc - Prendre de la hauteur en baskets, c'est possible avec ces belles basketsMustang 1319-305-100 !Cette basket Femme est blanche, composée de parties aspect grainé et d'autres poinçonnées.Il y a aussi des liserés argentés sur la tige de la basket Femme Mustang 1319-305-100.L'intérieur des chaussures Mustang Femme
  • Rieker Chaussure basse / Derby Femme Rieker - Argent,Beige,Blanc,Bleu,Bleu ciel,Bordeaux,Gris,Orange,Rose,Rouge,Vert - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Argent,Beige,Blanc,Bleu,Bleu ciel,Bordeaux,Gris,Orange,Rose,Rouge,Vert - Du grand confort au quotidien avec ces belles chaussures Femme Rieker AntistressN42V1-40 !Ces basketsbasses Femme sont grises et imprimé floral légèrement argenté.Les côtés de labasket de ville Femme sont perforés, avec un zip factice et décoratif.La languette en tissu gris est solidaire de la tige, tandis
  • Rieker Escarpin Femme Rieker - Gris - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Gris - Souples, toutes légères et très élégantes, ces jolieschaussures aéréesRieker 43750-45!La tige de l'escarpin fermé Rieker est quadrillée effet reptile, gris foncé avec de petites ouvertures en forme de pétales sur l'avant.La bride salomé habille le dessus du pied, avec une lanière à velcro pour fermer aisément
  • Tamaris Escarpin Femme Tamaris - Noir - Point. 35,36,37,38,39
    35,36,37,38,39 - Noir - Pour flatter votre silhouette, voici les escarpins pointus à talon haut Tamaris 1-24418-22 !Cette belle chaussure à talon aiguille est en cuir velouté noir, avec la tige en forme de vague.Parfaits pour le travail ou les soirées chics, ces escarpins noirs s'accorderont sans souci à toutes vos tenus...Détail
  • Jungla Chaussure montante Femme Jungla - Bleu,Noir - Point. 35,36,37,38,39,40,41
    35,36,37,38,39,40,41 - Bleu,Noir - Du grand confort pour ces belles boots Femme bleu marine et noir Jungla 6984 !Cette chaussure montante Femme est en cuir velouté bleu marine, avec un peu de cuir noir sur l'arrière et sur les côtés.Un large élastique bleu marine est fixé à la tige des boots, il traverse 5 oeillets métalliques afin d'enfiler
  • Marco Tozzi Escarpin Femme Marco Tozzi - Noir - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Noir - Un prix modéré pour être élégante en toutes occasions avec ces jolis escarpins noirs Marco Tozzi !La tige de la chaussure Femme est en textile velouté noir, avec bout pointu et talon aiguille.La doublure des escarpins noirs est en tissu, et la semelle de propreté Marco Tozzi Feel Me est matelassée.Le talon
  • Wrangler Chaussure en Toile Femme Wrangler - Beige,Bleu,Bleu ciel - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Beige,Bleu,Bleu ciel - On s'imagine en vacances rien qu'en les regardant, les baskets femme Wrangler Starry avec leur petits palmiers !Cette chaussure d'été est en toile bleu ciel, imprimée de palmiers sur toute la tige.Un empiècement en cuir marron camel est apposé sur l'arrière des sneakers avec le "W" de Wrangler.L'intérieur des
  • Marco Tozzi Chaussure aérée Femme Marco Tozzi - Beige - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Beige - Une tige aérée et un colorisbeige taupe facile à porter pour ces escarpins à petit talonMarco Tozzi 2-24503-22!La tige de la chaussure est finement ajourée et 2 élastiques reliés par un petit losange assurent un bon maintien du pied dans l'escarpin.La semelle intérieure Marco Tozzi Feel Me est matelassée pour
  • Esprit Chaussure montante Femme Esprit - Beige,Marron clair - Point. 36,37,38,39,40
    36,37,38,39,40 - Beige,Marron clair - Trop belles les baskets Femme vegan Esprit Cherry Warm !Ces sneakers montantes vegan sont en matières synthétiques marron clair (brown grey), avec des liserés pailletés qui habillent la tige.L'intérieur de cette chaussure Femme vegan est en fourrure textile beige, pour garder les pieds au chaud.Le lacet beige
  • Feel'In Sabot mode Femme Feel'In - Argent,Gris - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Argent,Gris - Un coloris gris argenté facile à porter et à associer pour ces jolis sabots FemmeFeel'in Habile!La tige de cettemule ferméeest ornée de dentelle pour une finition réussie.La doublure des sabots femme Feel in Habile est en toile imprimée.La semelle de marche de la chaussure Femme Feel in Habile est souple et
  • Alce Shoes Chaussure basse / Derby Femme Alce Shoes - Gris,Noir - Point. 35,36,37,38,39,40,41,42
    35,36,37,38,39,40,41,42 - Gris,Noir - La tige de ces chaussures Femme Alce 5813 allie parfaitement un cuir épais noir mat au cuir gris métal en forme de fleur qui couvre l'avant de la chaussure. Une bande élastique fermée par une pression maintien le coup de pied tout en lui procurant une bonne aisance.La doublure intérieure de ces chaussures
  • Enzo Marconi Chaussure habillée Homme Enzo Marconi - Noir - Point. 40,41,42,43,44,45,46
    40,41,42,43,44,45,46 - Noir - Facile d'être élégant sans dépenser trop avec les chaussuresEnzo Marconi 653-05 !La tige duderby Hommepetit prix est finement poinçonnée.La semelle de propreté est en cuir bleu, pour un meilleur confort dans le derby Enzo Marconi.Le lacet noir arrondi permet de fermer la chaussure traversant 4 oeillets.Mode,
  • Marco Tozzi Basket Femme Marco Tozzi - Argent,Blanc - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Argent,Blanc - Elles se démarquent avec leur semelle pailletée argent et leur pointe légèrement effilée, les sneakers blanches Marco Tozzi 2-23714-32 !La tige de cette belle basket Femme est réhaussée par des empiècements argent métal, avec un ruban rayé sur le côté externe.La doublure des chaussures Marco Tozzi 2-23714-32
  • Sprox Basket Femme Sprox - Beige,Bronze,Or - Point. 28,29,30,31,32,33,34,35,36,37,38,39
    28,29,30,31,32,33,34,35,36,37,38,39 - Beige,Bronze,Or - Pour apporter une note dorée à votre allure, voici des sneakers mode à petit prix Sprox 388073 !La tige de la basket est platine métallisé, avec le contrefort beige verni et plein de petites perles sur le devant.L'intérieur des sneakers femme est en tissu.Le lacet beige et or passe à travers 5 oeillets pour
  • Mustang Shoes Basket Femme Mustang Shoes - Jaune - Point. 36,37,38,39,40,41
    36,37,38,39,40,41 - Jaune - Le jaune est tendance, une bonne raison de craquer pour ces jolies basketsMustang 1354-304-6!Cette tennis Femme Mustang True Denim est jaune foncé, avec l'avant finement poinçonné et des petites touches argentées sur la tige.L'intérieur des baskets Femme jaunes Mustang est en toile du même ton que la tige.Le
  • Pikolinos Basket Femme Pikolinos - Beige,Blanc,Bordeaux - Point. 36,37,38,39,40
    36,37,38,39,40 - Beige,Blanc,Bordeaux - Elles ont tout pour plaire, ces magnifiques baskets Femme Pikolinos Sella!Leur cuir de grande qualité, leurs tons harmonieux de blanc cassé, de beige et de bordeaux, ainsi que leur grand confort !La tige de la basket Femme Pikolinos Sella est finement perforée de petits triangles de différentes
  • U-Power Baskets de sécurité S1P SRC POINT U-Power
    Ces chaussures de sécurité RedLion U-Power POINT sont normées S1P SRC. Elles sont dotées de la technologie anti-fatigue Infinergy® : amorti incroyable, économie d'énergie (55% de l'énergie restituée) et réduction des TMS. Très respirantes (embout AirToe®, tige et doublure), confortables (chaussant évolutif)
  • Point d Orgues Ville / Travail Homme Point d Orgues - Marron foncé - Point. 40,41,42,43,44,45
    Une ligne sobre et épurée au premier abord pour ces belles chaussures Homme en cuir marronPoint d Orgues !La tige du derbi Homme est réhaussée par l'empiècement rainuré sur l'arrière et les deux liserés camel sur les côtés.La doublure des chaussures est en textile, et la semelle de propreté matelassée est en
  • Moran's Ville / Travail Homme Moran's - Noir - Point. 39,40,41,42,43,44,45,46
    Le dessus de la tige est en cuir de couleur noir offrant un style épuré aux chaussures. Le cou de pied est maintenu par une bride velcro s'adaptant à votre pied.L'intérieur des chaussures Morans Brady noir est en cuir pour un environnement sain. La semelle de propreté en cuir des chaussures possède une voûte
  • Bopy Bottillon Bébé Bopy - Argent,Gris,Noir,Rose - Point. 18,19,20,21,22,23
    18,19,20,21,22,23 - Argent,Gris,Noir,Rose - Trop chics les bottillons bébé fille Bopy Zeana, c'est même inscrit sur le côté de la chaussure Bopy !Cette chaussure montante mélange un cuir verni noir et un cuir velouté gris pailleté, avec des broderies fantaisie sur les côtés.Un empiècement en cuir métal gris à l'arrière apporte une finition parfaite à
  • Geox Bottillon Bébé Geox - Bleu - Point. 21,22,23,24,25
    21,22,23,24,25 - Bleu - Grande qualité, confort et praticité avec ces belles chaussures montantes fille Geox Kaitan !Ce bottillon premiers pas Geox est en cuir et matières synthétiques résistantes bleu marine.Le côté externe de la chaussure enfant Geox B9451A est orné d'une broderie bleu ciel et de perles brillantes.Les petits pieds